Recombinant Mouse Potassium voltage-gated channel subfamily F member 1 (Kcnf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
Kcnf1; Potassium voltage-gated channel subfamily F member 1; Voltage-gated potassium channel subunit Kv5.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnf1
Target Protein Sequence
MDASAEQSLPEPGSQDSVAGEDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP ARVVAVLSFLLILVSSVVMCMGTIPELQVVDSEGNRVEHPTLENVETACIGWFTLEYLLR LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE TAAKHELELMELNSSSAEGKPGGSRSDLDTLPPEPAAREGPSWGSRLKLSHSDTFIPLLT EEKHHRTRLQSCK
Uniprot No.

Target Background

Function
Putative voltage-gated potassium channel.
Database Links
Protein Families
Potassium channel family, F (TC 1.A.1.2) subfamily, Kv5.1/KCNF1 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function and expression profile of mouse Kcnf1?

Mouse Kcnf1 (also known as Kv5.1) belongs to the voltage-gated potassium (Kv) channel family, which represents one of the most complex classes of voltage-gated ion channels from both functional and structural perspectives. These channels regulate diverse physiological processes including neurotransmitter release, neuronal excitability, heart rate, insulin secretion, epithelial electrolyte transport, smooth muscle contraction, and cell volume regulation .

Unlike many potassium channels, Kcnf1 is intronless and expressed in multiple tissues including heart, skeletal muscle, brain, kidney, and pancreas . The expression pattern suggests its importance across various organ systems, making it a valuable target for diverse research applications.

How does mouse Kcnf1 differ from human KCNF1?

While both mouse Kcnf1 and human KCNF1 belong to the same subfamily of voltage-gated potassium channels, researchers should be aware of several key differences:

  • Sequence homology: Mouse and human KCNF1 share approximately 85-90% amino acid identity, with the highest conservation in the pore region and voltage-sensing domains.

  • Tissue distribution: Though expressed in similar tissues, the relative expression levels may vary between species, potentially impacting translational research.

  • Electrophysiological properties: Subtle differences in activation and inactivation kinetics exist between species, which must be considered when extrapolating findings from mouse models to human applications.

What pathways involve Kcnf1 in physiological systems?

Kcnf1 participates in several critical biological pathways that are relevant to physiological and pathological conditions. Key pathways include:

Pathway NameRelated ProteinsBiological Significance
Potassium ChannelsKCNA1, KCNQ2, KCNK3A, KCNC1ARegulation of membrane potential and cellular excitability
Voltage-gated Potassium channelsKCNAB2B, KCNH1A, KCNQ2, KCNA1Control of action potential duration and frequency
Neuronal SystemKCNK13B, SYN3, CHRNB2, SLC1A2BModulation of neurotransmission and neuronal signaling

These pathway associations make Kcnf1 an important research target for understanding both normal physiology and disease mechanisms .

What expression systems are optimal for producing functional recombinant mouse Kcnf1?

The choice of expression system significantly impacts the yield and functionality of recombinant Kcnf1. Based on available research:

  • Mammalian expression systems (HEK293, CHO cells): Most effective for functional studies as they provide proper post-translational modifications and trafficking. HEK293 cells are particularly valuable for electrophysiological studies due to low endogenous potassium channel expression .

  • Bacterial systems (E. coli): While useful for producing protein fragments for structural studies or antibody generation, complete functional channels typically require mammalian expression systems due to the complexity of proper folding and assembly.

  • Expression tags: His, GST, DDK, Myc, Avi, and Fc tags have all been successfully used with mouse Kcnf1, with His and DDK tags showing minimal interference with channel function .

The methodology should be selected based on your specific research goals, with mammalian systems being preferred for functional studies and bacterial systems for high-yield protein production.

How can I validate the functional activity of recombinant mouse Kcnf1?

Validating functional activity of recombinant Kcnf1 requires a multi-faceted approach:

  • Electrophysiological techniques:

    • Patch-clamp recording remains the gold standard for functional characterization

    • Both whole-cell and single-channel recordings provide complementary information about channel kinetics and conductance

  • Fluorescence-based assays:

    • Membrane potential-sensitive dyes can provide high-throughput screening capabilities

    • FRET-based assays can detect voltage-dependent conformational changes

  • Biochemical validation:

    • Western blotting to confirm expression and molecular weight

    • Surface biotinylation assays to verify membrane localization

    • Co-immunoprecipitation to assess interaction with known binding partners

When interpreting results, remember that Kcnf1 belongs to the electrically silent KvS subfamily that cannot form functional homotetramers and must co-assemble with other Kv subunits to produce measurable currents.

What is the role of Kcnf1 in cancer and how can I study it in mouse models?

Recent research has revealed significant implications for Kcnf1 in cancer biology, particularly in lung cancer:

  • Expression patterns: KCNF1 has been identified as upregulated in non-small cell lung cancer (NSCLC), suggesting a potential role in cancer progression .

  • Functional significance:

    • Silencing KCNF1 in NSCLC cell lines reduced cell proliferation

    • KCNF1 knockdown inhibited tumor progression in mouse xenograft models

    • KCNF1 silencing re-established basement membrane integrity

    • Loss of KCNF1 enhanced cisplatin sensitivity

  • Molecular mechanisms:

    • KCNF1 is predominantly localized in the nucleoplasm

    • Functions appear to be ion-independent

    • Identified integrin β4 subunit (ITGB4) as a downstream target

When designing experiments to study Kcnf1 in cancer models, consider these methodological approaches:

  • Xenograft models: Human cancer cell lines with Kcnf1 modifications (knockdown or overexpression) implanted into immunocompromised mice

  • Genetically engineered mouse models: Tissue-specific Kcnf1 knockout or overexpression using Cre-lox systems

  • Patient-derived xenografts: To better recapitulate human tumor heterogeneity and microenvironment

  • Analysis techniques:

    • Tumor growth measurements

    • Immunohistochemistry for proliferation markers (Ki-67)

    • Assessment of basement membrane integrity

    • Drug sensitivity testing

These findings collectively implicate Kcnf1 as a potential novel therapeutic target for lung cancer .

How does Kcnf1 compare to other potassium channels as a therapeutic target?

When considering Kcnf1 as a therapeutic target, researchers should understand its unique properties relative to other potassium channels:

  • Functional characteristics:

    • Unlike many Kv channels, Kcnf1 (Kv5.1) belongs to the electrically silent KvS subfamily

    • Cannot form functional homotetramers but modulates activity of other Kv channels through heteromerization

    • May have ion-independent functions, particularly in cancer contexts

  • Tissue distribution:

    • Broad expression across multiple tissues including heart, skeletal muscle, brain, kidney, and pancreas

    • This widespread expression necessitates careful consideration of potential off-target effects

  • Therapeutic potential:

    • The upregulation in NSCLC suggests potential as an oncology target

    • Nuclear localization offers unique targeting opportunities compared to membrane-bound channels

    • Association with ITGB4 provides a specific pathway to target

When designing a therapeutic development program targeting Kcnf1, consider:

  • Small molecule modulators of channel function

  • Protein-protein interaction disruptors targeting Kcnf1-ITGB4 interaction

  • Antisense oligonucleotides or siRNA approaches for expression modulation

  • Evaluation of potential cardiac side effects due to expression in heart tissue

What are the key considerations for validating Kcnf1 antibodies for research use?

Antibody validation is critical for reliable Kcnf1 research, especially given its regulatory role in multiple pathways:

  • Specificity testing:

    • Western blot analysis using tissues from Kcnf1 knockout mice as negative controls

    • Peptide competition assays to confirm binding specificity

    • Testing across multiple species if cross-reactivity is desired

  • Application validation:

    • Separate validation for each application (Western blot, immunohistochemistry, immunoprecipitation)

    • Testing under both denaturing and native conditions

    • Verification of subcellular localization patterns in nucleoplasm and membrane

  • Common pitfalls:

    • Cross-reactivity with other Kv channel family members due to sequence homology

    • Variability between antibody lots

    • Different fixation protocols may affect epitope accessibility

How can I design effective experiments to study Kcnf1's role in heteromeric channel formation?

Kcnf1 (Kv5.1) is known to form heteromeric channels with other Kv2 family members, modulating their properties. For effective experimental design:

  • Co-expression systems:

    • Transfect cells with varying ratios of Kcnf1 and potential partner subunits

    • Use differentially tagged constructs to track individual subunits

    • Consider inducible expression systems to control timing of expression

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with antibodies against different subunits

    • FRET or BRET assays to demonstrate physical proximity

    • Surface plasmon resonance for quantitative binding kinetics

  • Functional characterization:

    • Patch-clamp electrophysiology to compare properties of homomeric vs. heteromeric channels

    • Voltage-clamp protocols to isolate specific conductances

    • Pharmacological profiling using subunit-specific blockers

  • Data analysis considerations:

    • Compare experimental data to mathematical models of channel assembly

    • Account for endogenous channel expression in chosen cell systems

    • Use multiple cell types to confirm consistency of interactions

What statistical approaches are most appropriate for analyzing Kcnf1 electrophysiological data?

Electrophysiological data from Kcnf1 studies requires specialized statistical approaches:

How should I interpret contradictory findings between different experimental models of Kcnf1 function?

When faced with contradictory results across different experimental systems:

  • Consider model-specific factors:

    • Expression levels may vary dramatically between systems

    • Presence of endogenous regulatory proteins

    • Species differences in channel properties or interacting proteins

    • Differences in post-translational modifications

  • Systematic validation approach:

    • Replicate key findings in multiple independent systems

    • Use complementary techniques to address the same question

    • Consider dose-dependent or temporal factors

    • Validate key findings in more physiologically relevant systems

  • Resolution strategies:

    • Side-by-side comparison of methodologies

    • Collaboration with laboratories using different approaches

    • Meta-analysis of published literature

    • Development of standardized protocols for the field

  • Interpretation framework:

    • Develop testable hypotheses to explain discrepancies

    • Consider context-dependent functions of Kcnf1

    • Evaluate whether contradictions represent truly different functions or methodological artifacts

What emerging technologies hold promise for advancing Kcnf1 research?

Several cutting-edge approaches are poised to transform our understanding of Kcnf1:

  • Structural biology advances:

    • Cryo-EM for determining heteromeric channel structures

    • Single-particle analysis for capturing multiple conformational states

    • Molecular dynamics simulations to predict functional implications of mutations

  • Genetic engineering tools:

    • CRISPR-Cas9 for generating precise mutations or regulated expression

    • Base editors for introducing specific amino acid changes

    • Conditional knockout models for tissue-specific studies

  • Functional imaging:

    • Genetically encoded voltage indicators for monitoring activity in live cells

    • Super-resolution microscopy for studying subcellular localization

    • Optogenetic approaches for temporal control of channel function

  • Therapeutic development platforms:

    • High-throughput screening of small molecule modulators

    • Structure-based drug design targeting Kcnf1-specific interfaces

    • RNA therapeutics for expression modulation

These emerging approaches provide opportunities to address longstanding questions about Kcnf1 function and potential therapeutic applications.

What are the priorities for understanding Kcnf1's role in disease pathogenesis?

Based on current knowledge and research gaps, these priorities emerge for disease-focused Kcnf1 research:

  • Cancer biology:

    • Expand studies beyond lung cancer to other cancer types

    • Detailed mapping of the Kcnf1-ITGB4 signaling pathway

    • Investigation of nuclear vs. membrane-associated functions

    • Development of predictive biomarkers based on Kcnf1 expression

  • Neurological disorders:

    • Assessment of Kcnf1 contributions to neuronal excitability in epilepsy models

    • Evaluation of potential roles in neurodegenerative disorders

    • Examination of Kcnf1 function in glial cells and neuroinflammation

  • Cardiovascular physiology:

    • Characterization of Kcnf1 contribution to cardiac action potential

    • Investigation of potential roles in arrhythmias

    • Evaluation of vascular smooth muscle function

  • Translational research priorities:

    • Development of more specific pharmacological tools

    • Validation in patient-derived samples

    • Correlation of genetic variants with disease phenotypes

By addressing these priority areas, researchers can advance both basic understanding of Kcnf1 biology and its potential clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.