Recombinant Mouse Potassium voltage-gated channel subfamily G member 4 (Kcng4)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Gene ID93107 (Human ortholog), 269632 (Mouse)
Protein Length506 amino acids (Mouse)
Molecular Weight~57–60 kDa (varies by expression system and tags)
Expression SystemsMammalian cells (HEK293), E. coli, cell-free synthesis
TagsHis, Fc, Avi, Strep, rho-1D4
Structural DomainsSix transmembrane helices (S1–S6), S4–S5 linker critical for gating

Functional Roles in Physiology

Kcng4 modulates Kv2.1 channel kinetics, influencing cellular excitability and developmental processes:

  • Neurological Regulation: Strong expression in brain tissues affects neurotransmitter release and neuronal excitability .

  • Developmental Pathways:

    • Governs Reissner fiber assembly and cerebrospinal fluid homeostasis via Kv2.1 interaction .

    • Regulates neuroepithelial cell proliferation during zebrafish brain development .

  • Disease Associations:

    • Migraines: The L360P variant disrupts Kv2.1 coupling, altering trigeminal nociceptor activity .

    • Hirschsprung’s disease: Downregulated in aganglionic colon segments .

    • Labor pain: Modulates uterine nociceptor excitability via Kv2.1 inactivation .

A. Research Use Cases

ApplicationExperimental ModelKey FindingsSource
ElectrophysiologyHEK293 cells + Kv2.1 co-expressionAltered activation/deactivation kinetics
Developmental studiesZebrafish (kcng4b mutants)Brain ventricle defects, otolith malformations
Disease modelingHuman dorsal root ganglia neuronsIncreased pain thresholds in KCNG4 variants

A. Mechanistic Insights

  • Kv2.1-Kcng4 Interaction:

    • Kcng4 shifts Kv2.1 inactivation voltage by ~40 mV, reducing channel availability .

    • Dominant-negative mutants (e.g., L360P) abolish Kv2.1 currents, exacerbating neuronal hyperexcitability .

  • Structural Impact:

    • The S4–S5 linker (residues 350–370) is critical for voltage-sensor-to-pore coupling .

    • Truncated mutants (e.g., kcng4b-C1) disrupt kinocilia formation in zebrafish .

B. Therapeutic Implications

ConditionMechanismOutcomeCitation
MigraineKv6.4-L360P reduces Kv2.1 currentTrigeminal nociceptor sensitization
Labor painK V6.4-Met419 depolarizes inactivationElevated action potential thresholds
Hirschsprung’s diseaseKCNG3/KCNG4 downregulationImpaired colonic motility

Technical Considerations

  • Expression Challenges:

    • Requires co-expression with Kv2.1 for functional channel assembly .

    • E. coli-expressed variants lack post-translational modifications .

  • Assay Compatibility:

    • SDS-PAGE/Western blotting (57–60 kDa bands) .

    • Electrophysiology (patch-clamp for current modulation analysis) .

Future Directions

  • High-Throughput Screening: Identify small molecules targeting Kv2.1-Kcng4 complexes for pain management .

  • Gene Therapy: Rescue KCNG4 loss-of-function in neurodevelopmental disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcng4; Potassium voltage-gated channel subfamily G member 4; Voltage-gated potassium channel subunit Kv6.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-506
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcng4
Target Protein Sequence
MPMSSRDRDLHPGHHHFGSCSPLSQLWPGPEPKSVKGLYYSRARKVGNQDASPEANLKEI LVNVGGQRYLLPWSTLDAFPLSRLSRLRLCRSHEEITQLCDDYDEDSQEFFFDRNPSAFG VIVSFLAAGKLVLLREMCALSFREELSYWGIEETNLERCCLRKLLKKLEEAAELRREEAA QRQQQRQACHSEVQASRWARSMNQLREMVEDPQSGLPGKVFACLSVLFVATTAVSLCVST MPDFRAEEGKGECTRKCYYIFVVESICVAWFSLEFCLRFVQAPNKCQFFRGPLNVIDILA ISPYYVSLAVSDESPEAGERPSSSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL TVRRCAREFGLLMLFLAVAVTLFSPLVYVAENESGRVLEFTSIPASYWWAIISMTTVGYG DMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKREQEQVQARLRRLQNTN SASERELLSDVDDLVPEGLTSPGRYM
Uniprot No.

Target Background

Function

Potassium channel subunit that does not form functional channels independently. It forms functional heterotetrameric channels with KCNB1, modulating the activation and deactivation rates of the KCNB1 delayed rectifier voltage-gated potassium channel.

Gene References Into Functions
  1. Targeted deletion of Kv6.4 in a transgenic mouse model resulted in male sterility. Offspring from homozygous females were only obtained after mating with wild-type or heterozygous males. Homozygous male sterility was due to a significant reduction in total sperm count and lack of motile spermatozoa. Spermatozoa from homozygous mice exhibited abnormal morphology, with smaller heads and shorter tails. PMID: 27677211
Database Links
Protein Families
Potassium channel family, G (TC 1.A.1.2) subfamily, Kv6.4/KCNG4 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Potassium Voltage-Gated Channel Subfamily G Member 4 (Kcng4)?

Kcng4, also known as Kv6.4, is a potassium channel subunit that cannot form functional channels independently. Instead, it operates as a modulatory subunit that forms functional heterotetrameric channels with other potassium channel subunits, particularly KCNB1 (Kv2.1). Kcng4 specifically modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1, thus playing a crucial role in regulating neuronal excitability . This modulatory function makes Kcng4 an important research target for understanding ion channel physiology and neuronal signaling mechanisms.

What is the molecular structure of recombinant mouse Kcng4?

Recombinant mouse Kcng4 protein typically consists of 506 amino acids with a molecular weight of approximately 57.2 kDa . The full amino acid sequence begins with MPMSSRDRDL and contains essential domains for membrane insertion, voltage sensing, and interaction with other channel subunits. The protein structure includes transmembrane domains that anchor it within the cell membrane and functional domains that allow for interaction with Kv2.1 channels. When studying recombinant Kcng4 proteins, researchers should consider the protein's complete tertiary structure to understand its functional properties.

How does Kcng4 expression vary across different tissue types?

In mouse models, Kcng4 shows specific expression patterns with significant presence in sensory neurons. Notably, Kcng4 is expressed in approximately 40% of retrograde-labeled mouse uterine sensory neurons . Research has demonstrated that virtually all neurons expressing Kcng4 also express Kv2.1, its functional partner, and over 90% of these neurons express the nociceptor genes Trpv1 and Scn10a . This co-expression pattern suggests a coordinated role in pain sensation and neuronal excitability, making Kcng4 particularly relevant for pain research and sensory neuron studies.

What expression systems are optimal for producing functional recombinant mouse Kcng4?

For optimal production of functional recombinant mouse Kcng4, researchers have multiple expression system options, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
Cell-free protein synthesis (CFPS)Rapid production, avoids cellular toxicity issuesMay have lower post-translational modificationsModerate purity (70-80%)
HEK-293 cellsMammalian post-translational modifications, high expressionMore time-consuming, higher costHigher purity (>90%)
E. coliCost-effective, high yieldLimited post-translational modificationsVariable purity

Cell-free protein synthesis has been successfully employed for producing recombinant Kcng4 with Strep tags, achieving 70-80% purity as determined by SDS-PAGE and Western blot analysis . For applications requiring higher purity, expression in HEK-293 cells has demonstrated >90% purity when combined with appropriate affinity purification strategies .

What purification methods yield highest purity recombinant Kcng4?

One-step Strep-tag purification has proven effective for recombinant Kcng4 expressed in cell-free systems, yielding proteins with 70-80% purity . For higher purity requirements, researchers should consider:

  • Using His-tag purification combined with size exclusion chromatography, which can achieve >90% purity as confirmed by Bis-Tris PAGE, anti-tag ELISA, Western blot, and analytical SEC (HPLC) .

  • Implementing optimized buffer conditions during purification to maintain protein stability, typically utilizing PBS pH 7.4 with 10% glycerol as a standard storage buffer .

  • Validating purification success through multiple analytical techniques, including SDS-PAGE, Western blotting, and analytical SEC to ensure both purity and functional integrity.

What techniques are most effective for studying Kcng4 trafficking to the plasma membrane?

Investigation of Kcng4 trafficking requires techniques that can distinguish between membrane-localized and intracellularly retained protein. Research on the Kv6.4-Met419 variant has demonstrated the importance of trafficking in channel function, as this variant fails to traffic properly to the plasma membrane, resulting in altered functional properties . Effective methodologies include:

  • Fluorescent protein tagging combined with confocal microscopy to visualize subcellular localization

  • Cell surface biotinylation assays followed by Western blotting to quantify membrane expression

  • Patch-clamp electrophysiology combined with immunocytochemistry to correlate localization with function

  • FRET or BRET techniques to study protein-protein interactions during trafficking

When applying these techniques, researchers should include appropriate controls such as wild-type Kcng4 and established markers for subcellular compartments to accurately interpret trafficking patterns.

How does Kcng4 modulate Kv2.1 channel function?

Kcng4 forms functional heterotetrameric channels with KCNB1 (Kv2.1) and modulates its delayed rectifier voltage-gated potassium channel activation and deactivation rates . This modulatory effect significantly impacts neuronal excitability. When Kcng4 associates with Kv2.1, it alters the voltage dependence of inactivation, a critical property that determines channel availability during repetitive firing .

Studies comparing wild-type Kv6.4 with the variant Kv6.4-Met419 demonstrate that proper trafficking of Kv6.4 to the plasma membrane is essential for this modulatory function. When co-expressed with Kv2.1, wild-type Kv6.4 significantly shifts the voltage dependence of inactivation, whereas Kv6.4-Met419, which fails to traffic properly, cannot produce this shift . This functional difference has significant implications for neuronal excitability and sensory function.

What electrophysiological approaches best characterize Kcng4 channel properties?

To effectively characterize Kcng4 channel properties, researchers should employ:

  • Voltage-clamp protocols: Particularly focusing on activation and inactivation kinetics

  • Current-clamp recordings: To assess the impact on action potential threshold and firing patterns

  • Co-expression systems: Studying Kcng4 with Kv2.1 in heterologous expression systems

Research has shown that the voltage dependence of inactivation for Kv2.1 is more depolarized in neurons overexpressing Kv6.4-Met419 compared to those overexpressing wild-type Kv6.4 . Additionally, neurons overexpressing Kv6.4-Met419 demonstrate a higher action potential threshold, indicating reduced excitability . These findings highlight the importance of comprehensive electrophysiological characterization in understanding Kcng4 function.

How do Kcng4 variants affect sensory neuron excitability?

Variants of Kcng4, such as Kv6.4-Met419, can significantly alter sensory neuron excitability. Research indicates that the rare variant Kv6.4-Met419 has a dominant-negative effect and cannot modulate the voltage dependence of Kv2.1 inactivation due to its failure to traffic to the plasma membrane . This trafficking defect leads to altered neuronal excitability properties.

Specifically, neurons overexpressing Kv6.4-Met419 exhibit a higher action potential threshold compared to neurons overexpressing wild-type Kv6.4 . This increased threshold indicates reduced excitability, which has significant implications for sensory function, particularly in pain perception. These findings suggest that Kcng4 variants can influence human pain perception by modulating the excitability of sensory neurons, including uterine nociceptors involved in labor pain .

How does Kcng4 contribute to pain perception in physiological contexts?

Research has revealed a significant role for Kcng4 in pain perception, particularly in the context of labor pain. Studies in humans have identified a rare variant of KCNG4 (rs140124801) that is over-represented in women who did not require analgesia during their first childbirth . This variant encodes Kv6.4-Met419, which fails to traffic to the plasma membrane and thus cannot modulate Kv2.1 channel function in the same way as wild-type Kv6.4.

The physiological impact of this variant appears to be increased pain thresholds. Individuals carrying the rare KCNG4 allele demonstrated significantly increased cuff pressure pain thresholds compared to controls (p = 0.0029, uncorrected; p = 0.009, Sidak's correction) . These findings suggest that Kcng4 function directly influences pain perception, with the Kv6.4-Met419 variant potentially reducing sensory neuron excitability and consequently increasing pain tolerance.

How should researchers address contradictory data in Kcng4 studies?

When encountering contradictory data in Kcng4 research, investigators should implement a systematic approach to analysis and validation:

  • Methodological comparison: Carefully examine differences in experimental protocols, expression systems, and measurement techniques that might account for discrepancies

  • Statistical reanalysis: Apply appropriate statistical methods for analyzing electrophysiological data, considering sample sizes and potential outliers

  • Meta-analytical approaches: Integrate findings across multiple studies while accounting for methodological heterogeneity

  • Validation experiments: Design experiments specifically to test contradictory findings using multiple complementary techniques

The field of clinical contradiction detection has developed automated approaches for identifying and analyzing contradictory claims in medical literature . These approaches can be adapted to analyze contradictions in Kcng4 research, particularly when integrating findings across multiple studies with varying methodologies.

What are the implications of Kcng4 research for pain management therapies?

Kcng4 research has significant implications for developing novel pain management therapies. The discovery that a Kcng4 variant (Kv6.4-Met419) is associated with reduced labor pain sensitivity suggests that targeting Kcng4 or its interaction with Kv2.1 could provide new therapeutic pathways for pain management .

Potential therapeutic approaches might include:

  • Developing compounds that modulate Kv6.4-Kv2.1 interactions to reduce sensory neuron excitability

  • Targeting the trafficking mechanisms of Kv6.4 to alter its membrane expression

  • Gene therapy approaches to express modified Kv6.4 in specific sensory neurons

  • Personalized medicine strategies based on KCNG4 genotyping to predict pain sensitivity

Further research is needed to fully elucidate the mechanistic pathways by which Kcng4 modulates pain perception and to develop targeted interventions that can effectively modulate these pathways for therapeutic benefit.

What controls are essential when studying recombinant Kcng4?

When studying recombinant Kcng4, researchers must implement comprehensive controls to ensure valid and reproducible results:

Control TypePurposeImplementation
Protein expression controlsVerify successful expressionWestern blotting with anti-tag antibodies and specific Kcng4 antibodies
Localization controlsConfirm proper subcellular distributionCo-localization with membrane markers and subcellular compartment markers
Functional controlsValidate channel activityElectrophysiological recording of Kv2.1 alone compared to Kv2.1+Kcng4
Specificity controlsEnsure observed effects are Kcng4-specificTesting multiple tags, tag positions, and tag-free constructs
Negative controlsControl for non-specific effectsEmpty vector transfections and irrelevant protein controls

Research has demonstrated that when co-expressing Kv6.4 with Kv2.1, it is crucial to verify that the current amplitude generated is similar between wild-type Kv6.4 and variant forms (e.g., Kv6.4-Met419), ensuring that any differences in function are not due to expression level variations .

How can researchers effectively study Kcng4 in native neuronal systems?

Studying Kcng4 in native neuronal systems requires specialized approaches to maintain physiological relevance:

  • Retrograde labeling: This technique has successfully identified Kcng4-expressing uterine sensory neurons in mouse models, revealing that Kcng4 is expressed in approximately 40% of these neurons

  • Single-cell analysis: Combine electrophysiology with single-cell transcriptomics to correlate Kcng4 expression with functional properties

  • In vivo knockdown/knockout: Use targeted genetic approaches to modify Kcng4 expression in specific neuronal populations

  • Ex vivo preparations: Utilize tissue slices or isolated DRG neurons to study Kcng4 function in a more native context

These approaches provide complementary insights into Kcng4 function, allowing researchers to validate findings from heterologous expression systems in more physiologically relevant contexts. For instance, studies in retrograde-labeled mouse uterine sensory neurons have confirmed that virtually all Kcng4-expressing neurons also express Kv2.1 and nociceptive markers like Trpv1 and Scn10a .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.