Recombinant Mouse Potassium voltage-gated channel subfamily KQT member 1 (Kcnq1)

Shipped with Ice Packs
In Stock

Description

Compound Overview: Recombinant Mouse Potassium Voltage-Gated Channel Subfamily KQT Member 1 (KCNQ1)

Recombinant mouse KCNQ1 is a full-length, His-tagged protein derived from the Kcnq1 gene, which encodes a voltage-gated potassium (K<sup>+</sup>) channel critical for cellular repolarization. Expressed in E. coli, this recombinant protein is utilized in research to study channel function, structural biology, and disease mechanisms linked to LQT1 (long QT syndrome type 1) and other cardiac disorders .

Functional Role

  • Cardiac repolarization: Forms heterotetramers with KCNE subunits (e.g., KCNE1) to generate the slow delayed rectifier current (I_Ks) .

  • Phosphatidylinositol-4,5-bisphosphate (PIP2) binding: Stabilizes the open state and facilitates K<sup>+</sup> efflux .

  • Tissue-specific expression: Critical in the heart, stomach, and inner ear .

Disease Relevance

Disease AssociationMechanismSource
LQT1Loss-of-function mutations disrupt I_Ks and prolong cardiac action potentials
Jervell and Lange-Nielsen syndromeHomozygous Kcnq1 mutations cause congenital deafness and arrhythmias

Gene Therapy Potential

  • Suppression-replacement (SupRep) therapy: A dual-component approach using shRNA to suppress endogenous Kcnq1 and a shRNA-immune cDNA to restore WT expression. This strategy corrected prolonged action potentials in iPSC-derived cardiomyocytes from LQT1 patients .

Protein Production and Purification

StepMethod
ExpressionInduced in E. coli with IPTG; soluble expression confirmed via SDS-PAGE
PurificationNi-NTA affinity chromatography (His-tag)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Functional Assays

  • Electrophysiology: Two-electrode voltage clamp in Xenopus oocytes to measure I_Ks currents .

  • Immunoprecipitation: Co-IP with KCNE1-CT to study subunit interactions .

  • Surface plasmon resonance (SPR): Quantifies binding affinity between KCNQ1-CT and KCNE1-CT (K<sub>d</sub> ~4 μM) .

Related Proteins and Interactions

ProteinInteractionFunction
KCNE1Stabilizes open state, slows activationModulates I_Ks kinetics
CalmodulinBinds C-terminal domain, regulates deactivationCalcium-dependent gating
AKAP9Anchors PKA to KCNQ1, enabling β-adrenergic regulationModulates channel phosphorylation

Clinical and Physiological Implications

  • Cardiac arrhythmias: Mutations in Kcnq1 disrupt repolarization, increasing susceptibility to torsades de pointes .

  • Non-cardiac roles: Regulates gastric acid secretion, thyroid hormone synthesis, and salt balance .

  • Imprinting and epigenetics: Kcnq1 is maternally imprinted in some tissues, influencing Beckwith-Wiedemann syndrome .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
Kcnq1; Kcna9; Kvlqt1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-668
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnq1
Target Protein Sequence
MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGPEGSTVYAPIAPTGAPG LAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWK CFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCR SKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHV DRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYAD ALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQ KHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARSHTLLSPSPKPKKSVMVKKK KFKLDKDNGMSPGEKMFNVPHITYDPPEDRRPDHFSIDGYDSSVRKSPTLLEVSTPHFLR TNSFAEDLDLEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDV IEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQ LDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVP QTGPDEGS
Uniprot No.

Target Background

Function
Potassium channel that plays an important role in a number of tissues, including heart, inner ear, stomach and colon. Associates with KCNE beta subunits that modulate current kinetics. Induces a voltage-dependent by rapidly activating and slowly deactivating potassium-selective outward current. Promotes also a delayed voltage activated potassium current showing outward rectification characteristic. During beta-adrenergic receptor stimulation participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current that increases the amplitude and slows down the activation kinetics of outward potassium current I(Ks). Muscarinic agonist oxotremorine-M strongly suppresses KCNQ1/KCNE1 current. When associated with KCNE3, forms the potassium channel that is important for cyclic AMP-stimulated intestinal secretion of chloride ions. This interaction with KCNE3 is reduced by 17beta-estradiol, resulting in the reduction of currents. During conditions of increased substrate load, maintains the driving force for proximal tubular and intestinal sodium ions absorption, gastric acid secretion, and cAMP-induced jejunal chloride ions secretion. Allows the provision of potassium ions to the luminal membrane of the secretory canaliculus in the resting state as well as during stimulated acid secretion. When associated with KCNE2, forms an heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current. When associated with KCNE4, inhibits voltage-gated potassium channel activity. When associated with KCNE5, this complex only conducts current upon strong and continued depolarization. Also forms a heterotetramer with KCNQ5; has a voltage-gated potassium channel activity. Binds with phosphatidylinositol 4,5-bisphosphate.
Gene References Into Functions
  1. Our data indicate that mouse embryonic stem cells can be induced into islet-like cells in vitro. The gene imprinting status of Kcnq1 and Cdkn1c may be altered in differentiated cells during the induction process in vitro. PMID: 28926866
  2. Collectively, our research suggests that Prmt1-dependent facilitation of the KCNQ-phosphatidylinositol-4,5-bisphosphate interaction underlies the positive regulation of KCNQ activity by arginine methylation. This may serve as a crucial target for preventing neuronal hyperexcitability and seizures. PMID: 27466704
  3. We investigated the effects of KCNQ1 A340E, a loss-of-function mutant. J343 mice carrying KCNQ1 A340E exhibited a significantly higher 24-hour intake of electrolytes (potassium, sodium, and chloride). Therefore, KCNQ1 is proposed to play a pivotal role in electrolyte metabolism. KCNQ1 A340E, with its loss-of-function phenotype, may disrupt electrolyte homeostasis PMID: 27525866
  4. Loss of methylation at the Kcnq1 imprinted gDMD was strongly associated with trophoblast giant cell (TGC) expansion. PMID: 26241757
  5. Our data demonstrate that disruption of the potassium voltage-gated channel, KQT-like subfamily Q, member 1 (KCNQ1) results in increased expression of cyclin-dependent kinase inhibitor 1C (Cdkn1c) only when the mutation is on the paternal allele. PMID: 26100882
  6. S3 mutations in KCNQ1 cause diverse kinetic defects in I(Ks), affecting opening and closing properties, and can account for LQT1 phenotypes. PMID: 25444851
  7. Characterization of the imprinted Kcnq1 domain which contains a differentially methylated region in intron 11 of Kcnq1. PMID: 25539921
  8. KCNQ1, KCNE2, and SMIT1 form reciprocally regulating complexes that influence neuronal excitability. PMID: 24595108
  9. Low expression of KCNQ1 expression was significantly associated with poor overall survival. PMID: 23975432
  10. Which participates in the allelic repression of Kcnq1. PMID: 24395636
  11. H(+)-K(+)-ATPase/KCNQ1 reside in independent intracytoplasmic membrane compartments, or membrane domains, and upon activation of parietal cells, both membrane proteins are transported, possibly via Rab11-positive recycling endosomes, to apical membranes. PMID: 23154976
  12. Our studies reveal regulatory mechanisms within the Kcnq1 imprinted domain that operate exclusively in the heart on Kcnq1, a gene crucial for heart development and function. PMID: 23028363
  13. Expression of KCNQ1 and NKCC1 protein in the stria vascularis of C57BL/6J mice decreases with age. PMID: 21426709
  14. We observed disruptions in parietal cell differentiation and mucous neck-to-zymogenic cell lineage differentiation with enhanced expression of KCNQ1 in the parietal cells. PMID: 20437101
  15. Data indicate that in early pregnant mouse myometrium, the relative abundance of mRNA expression was KCNQ3 > KCNQ4 > KCNQ5 > KCNQ1 > KCNQ2. PMID: 20132415
  16. Kcnq1 is expressed in the cell membrane of thyroid follicular cells and plays a significant role in thyroid function. Plasma concentrations of T3/T4 are lower in Kcnq1 knockout mice compared to their wild-type littermates PMID: 20978783
  17. Repression of the paternal allele of several imprinted genes (including Kcnq1) on distal chromosome 7 is regulated by a non-coding antisense transcript, Kcnq1ot1, which is paternally expressed. PMID: 17021040
  18. KCNQ1 loss-of-function mutation impairs gastric acid secretion in mice. PMID: 19306073
  19. Data suggest that although KCNQ1 is expressed in nearly all taste bud cells, its function is not essential for gross taste bud development or peripheral taste transduction pathways. PMID: 19006182
  20. The mutation of KCNQ1 potassium channel did not affect channel kinetics, whereas surface expression increased with increasing hydrophobicity of the middle amino acid residue. PMID: 19041715
  21. The effect of APC in the regulation of gastric acid secretion requires H+/K+ ATPase activity and is at least partially due to SGK1-dependent upregulation of KCNQ1. PMID: 19255508
  22. The observations indicate that KCNQ1 is a novel molecule influencing insulin sensitivity of glucose metabolism. PMID: 19369585
  23. A 166 kb region near the Kcnq1 transcriptionally imprinted domain showed high recombination activity. PMID: 19439080
  24. KCNQ1 channel provides K(+) to the extracellular K(+) binding site of the H(+)/K(+)-ATPase during acid secretion, and no other gastric K(+) channel can substitute for this function. PMID: 19491250

Show More

Hide All

Database Links
Protein Families
Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.1/KCNQ1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Early endosome. Membrane raft. Endoplasmic reticulum. Basolateral cell membrane.
Tissue Specificity
Expressed in heart, kidney and salivary glands. Detected in the cochlea. Almost undetectable in brain, skeletal muscle and liver. Widely expressed in embryonic and neonatal tissues.

Q&A

What is the molecular structure of KCNQ1 and how does it function in different physiological systems?

KCNQ1 (Kv7.1) is a voltage-dependent potassium channel that forms as a tetramer of α subunits. Each subunit contains six transmembrane segments with segments 1-4 (S1-S4) forming one voltage sensing domain (VSD) and S5-S6 contributing to an interlocking pore structure . The VSD contains a transmembrane S4 helix with periodic basic residues that sense membrane potential changes .

KCNQ1 plays diverse physiological roles:

  • In cardiac tissue: Forms IKs current with KCNE1 subunit for action potential repolarization

  • In inner ear: Essential for endolymph K+ homeostasis

  • In epithelial tissues: Regulates salt and water transport in lungs, stomach, intestine, and kidney

Recent structural studies using cryo-electron microscopy have revealed detailed conformational states of KCNQ1, including homology models that have been confirmed by experimental structures with VSD and pore domain (PD) conformations highly similar to predicted models (Cα-RMSD for VSD and PD less than 1.9 Å and 2.0 Å, respectively) .

How do loss-of-function mutations in KCNQ1 cause cardiac arrhythmias, and what mechanisms have been identified?

Loss-of-function (LOF) pathogenic variants in KCNQ1 give rise to long QT syndrome (LQTS), predisposing patients to sudden cardiac death . Recent integrative analysis of 61 KCNQ1 variants distributed throughout channel domains identified diverse molecular mechanisms underlying channel dysfunction :

MechanismPrevalenceDomain DistributionFunctional Impact
Impaired traffickingMost commonAll domainsRetention in ER, reduced surface expression
Protein instabilityCommonOften coincides with trafficking defectsDegradation, reduced channel density
Normal trafficking with impaired conductanceCommon in transmembrane domainsParticularly in S1-S6Reduced K+ current despite surface expression
Altered voltage dependenceVariableParticularly in VSDShifted activation threshold
Abnormal gating kineticsVariableVarious domainsSlowed activation/deactivation

This diversity of pathogenic mechanisms indicates the need for personalized treatment approaches for LQTS . Importantly, prediction accuracy for variant pathogenicity depends on the specific mechanism, with current computational tools showing limitations in distinguishing between different types of dysfunction .

What experimental approaches can be used to assess KCNQ1 channel function in vitro?

Several sophisticated methodologies have been established for studying KCNQ1 function:

  • Electrophysiology techniques:

    • Two-electrode voltage clamp (TEVC) in Xenopus oocytes

    • Patch clamp in mammalian cell lines (CHO, COS-7)

    • These methods allow measurement of current magnitude, voltage dependence, and kinetics

  • Protein trafficking assessment:

    • Fluorescence microscopy to visualize subcellular localization

    • Cell surface biotinylation assays to quantify membrane expression

    • Co-immunoprecipitation to detect protein-protein interactions

  • Structural biology approaches:

    • Rosetta protein-protein docking for modeling KCNQ1 interactions with modulatory proteins

    • Molecular dynamics simulations to assess conformational dynamics

    • Cryo-EM for determining channel structure

For example, KCNQ1 function can be studied by expressing the channel in heterologous systems with potential modulatory proteins. This approach revealed that KCNQ1 can rescue TMC1 surface expression when co-expressed in CHO cells, despite having no known physiological interaction in vivo, providing insight into protein trafficking mechanisms .

What is the regulatory role of KCNE subunits in KCNQ1 channel function, and how can this be experimentally investigated?

KCNE1 (MinK) profoundly modulates KCNQ1 function, particularly in cardiac tissue. Key regulatory effects include:

  • Dramatically slows KCNQ1 activation kinetics

  • Increases unitary conductance

  • Alters pharmacological sensitivity

  • Changes voltage-dependence properties

Several models explain KCNE1 modulation mechanisms:

  • Direct slowing of S4 movement in the voltage sensor domain

  • Slowing of pore opening without affecting voltage sensor movement

  • Requiring multiple voltage sensor movements before channel opening

Experimental approaches to investigate KCNE-KCNQ1 interactions include:

  • Structural modeling using experimental restraints collected from biophysical experiments

  • Site-directed mutagenesis to identify interaction residues

  • Chimeric channel constructs to define functional domains

  • Electrophysiological recordings to determine functional effects

Recent structural models of KCNQ1-KCNE1 complexes in both closed and open conformations were developed using iterative Rosetta protein-protein docking with experimental restraints, revealing the molecular basis for KCNE1 modulation . The models satisfied experimental restraints remarkably well, with most restrained KCNQ1-KCNE1 Cα-Cα distances below the 12 Å cutoff employed in docking .

How can recombinant KCNQ1 be used for high-throughput screening of potential therapeutic compounds?

For high-throughput screening of compounds targeting KCNQ1, several methodological approaches have been developed:

  • Fluorescence-based assays:

    • Membrane potential dyes that respond to K+ flux

    • FRET-based reporters of conformational changes

    • These enable rapid screening of thousands of compounds in 384- or 1536-well formats

  • Automated electrophysiology platforms:

    • Planar patch clamp systems allow medium-throughput functional assessment

    • Capable of detecting subtle changes in channel kinetics and voltage dependence

    • Provide direct measurement of channel function rather than surrogate markers

  • Cell-based assays for trafficking rescue:

    • Since many KCNQ1 mutations affect trafficking, compounds can be screened for ability to rescue surface expression

    • Particularly relevant for LOF mutations where impaired trafficking is the primary defect

  • Structure-based virtual screening:

    • Using the resolved structures of KCNQ1 for in silico docking

    • Allows prioritization of compounds before experimental testing

    • Can target specific functional domains based on mutation mechanism

When designing such screening approaches, it's critical to account for the diversity of pathogenic mechanisms identified in KCNQ1 variants, as different therapeutic strategies may be required depending on whether the defect involves trafficking, conductance, or gating properties .

What are the genomic organization and transcriptional regulation mechanisms of the KCNQ1 gene?

The KCNQ1 gene has a complex genomic organization:

  • Genomic structure:

    • Located on chromosome 11p15.5

    • Consists of 19 exons spanning approximately 400 kb

    • Contains (CA)n repeat microsatellites in introns 10 and 14

  • Transcriptional regulation:

    • Subject to tissue-specific enhancer-driven expression

    • Regulated by the long non-coding RNA Kcnq1ot1, which affects chromatin conformation

    • In heart development, shows unique regulation with progressive activation of the paternal allele

  • Imprinting and epigenetic control:

    • KCNQ1 is located in an imprinted region containing imprinting control region 2

    • This region regulates the imprinting of nearby genes such as CDKN1C

    • Defects in this imprinted region can cause growth disorders like Beckwith-Wiedemann syndrome

Research has shown that during heart development, the paternal KCNQ1 allele becomes progressively activated, reaching 88% of maternal allele RNA abundance . This activation coincides with tissue-specific enhancer-driven expression. Studies in KCNQ1ot1-deficient mice (K-term) demonstrated that absence of KCNQ1ot1 leads to KCNQ1 overexpression in the heart starting at E16.5, indicating that KCNQ1ot1 plays a role in regulating KCNQ1 levels .

What methods can be used to express and purify recombinant mouse KCNQ1 for structural studies?

Expressing and purifying functional KCNQ1 for structural studies presents significant challenges due to its complex membrane protein nature. Successful approaches include:

  • Expression systems:

    • Mammalian cell lines (HEK293S GnTI- cells) for proper folding and post-translational modifications

    • Insect cells (Sf9, High Five) using baculovirus expression systems

    • Cell-free expression systems supplemented with lipid nanodiscs

  • Construct optimization strategies:

    • Fusion with stability-enhancing tags (GFP, MBP)

    • Truncation of flexible regions while maintaining core function

    • Co-expression with stabilizing antibody fragments or nanobodies

    • Introduction of thermostabilizing mutations

  • Purification workflow:

    • Solubilization with mild detergents (DDM, LMNG)

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final purification

    • Reconstitution into lipid nanodiscs or amphipols for increased stability

Recent structural studies of human KCNQ1 used cryo-EM methods , requiring highly pure, homogeneous, and stable protein preparations. Molecular modeling approaches have also been valuable, using homology with related channels like Xenopus KCNQ1 and the Kv1.2/2.1 chimera . The models developed through these approaches have been validated by subsequent experimental structures, with high structural similarity confirming their accuracy .

How can gene therapy approaches be used to treat KCNQ1-related disorders, and what delivery methods are most effective?

Gene therapy shows promise for treating KCNQ1-related disorders, as demonstrated in a mouse model of Jervell and Lange-Nielsen syndrome:

  • Viral vector selection and optimization:

    • Modified adeno-associated virus (AAV) constructs carrying KCNQ1 expression cassettes have shown efficacy

    • Vector design must include tissue-specific promoters to target expression to relevant cell types

  • Delivery approaches for different target tissues:

    • For inner ear: Direct injection into the endolymph during early postnatal period (P0-P2)

    • For cardiac tissue: Intracoronary or systemic delivery with cardiac-specific promoters

    • Timing is critical; intervention before permanent histological changes occur is essential

  • Efficacy assessment parameters:

    • Expression analysis in target tissues (61-75% transduction efficiency in marginal cells was sufficient to prevent deafness)

    • Functional recovery (electrophysiological testing, endocochlear potential)

    • Prevention of structural defects (prevented collapse of Reissner's membrane and degeneration of hair cells)

One study demonstrated significant hearing preservation in KCNQ1-null mice treated with AAV-KCNQ1, ranging from 20 dB improvement to complete correction of the deafness phenotype . Importantly, the treatment was most effective when administered before permanent histological changes occurred, highlighting the importance of early intervention. This represented the first successful gene therapy treatment for gene defects affecting the stria vascularis .

What tools and methods are available for predicting the pathogenicity of novel KCNQ1 variants?

Predicting the pathogenicity of KCNQ1 variants requires specialized tools and approaches:

  • KCNQ1-specific prediction algorithms:

    • Q1VarPred: A neural network specifically trained on functionally characterized KCNQ1 variants

    • Demonstrates superior performance (Matthew's correlation coefficient: 0.581; area under ROC curve: 0.884) compared to general prediction methods

  • Integrative analysis approaches:

    • Combining biophysical, functional, and trafficking properties to classify pathogenic mechanisms

    • Allows more accurate interpretation than single-parameter assessments

  • Conservation analysis:

    • Analysis of sequence conservation patterns in KCNQ1 subdomains

    • Conserved subdomains are generally critical for channel function and enriched with dysfunctional variants

  • Structural modeling:

    • Using existing KCNQ1 structures to predict the impact of mutations on protein folding and function

    • Molecular dynamics simulations to assess effects on channel dynamics

Study of 107 functionally characterized KCNQ1 variants revealed important insights about pathogenicity prediction :

  • Approximately 10% of variants identified in LQTS patient cohorts were functionally normal, suggesting potential false positives

  • 8 out of 99 case variants caused only mild loss of function

  • General pathogenicity prediction tools often fail to perform robustly when applied specifically to KCNQ1

  • Prediction accuracy depends on the exact mechanism of pathogenicity associated with a given variant

How do KCNQ1 channels interact with other proteins in multiprotein complexes, and what methods can detect these interactions?

KCNQ1 functions within complex protein networks, with several experimentally validated interaction partners:

  • Known interacting partners:

    • KCNE family members (especially KCNE1) modulate channel gating and pharmacology

    • PIP2 (phosphatidylinositol 4,5-bisphosphate) stabilizes KCNQ1 channel in an open state

    • TMC1 (transmembrane channel-like protein 1) forms complexes with KCNQ1

  • Methods to detect and characterize protein-protein interactions:

    • Co-immunoprecipitation followed by mass spectrometry

    • FRET/BRET biosensor approaches for live-cell interaction detection

    • Electrophysiological analysis of functional consequences

    • Crosslinking coupled with mass spectrometry for interface mapping

  • Structural characterization of complexes:

    • Rosetta protein-protein docking with experimental restraints

    • Iterative model refinement based on experimental data

    • Molecular dynamics simulations to assess complex stability

An interesting interaction example involves TMC1, an essential protein for mechanotransduction in auditory hair cells. When heterologously expressed alone, TMC1 remains in the endoplasmic reticulum, but co-expression with KCNQ1 rescues its surface expression in CHO cells . This rescue is specific for KCNQ1 within the KCNQ family, is prevented by KCNQ1 trafficking-deficient mutations, and is influenced by KCNE β subunits . This suggests KCNQ1 may share structural elements with a true in vivo TMC1 partner, providing insights into potential therapeutic approaches for TMC1-related disorders.

What is the role of the S4-S5 linker and PIP2 in regulating KCNQ1 channel gating?

The S4-S5 linker (S4S5L) and phosphatidylinositol 4,5-bisphosphate (PIP2) have opposing effects on KCNQ1 channel gating:

  • S4-S5 linker regulatory mechanism:

    • Acts as a ligand binding to the S6 C-terminal part (S6T) to stabilize the channel in a closed state

    • Serves as a critical coupling element between the voltage-sensing domain and the activation gate

    • Mutations in this region can dramatically alter voltage-dependent gating properties

  • PIP2 regulatory mechanism:

    • Stabilizes KCNQ1 channel in an open state, opposing the S4-S5 linker action

    • Functions as a crucial cofactor for KCNQ1 and many other ion channels

    • Altered regulation by PIP2 can lead to channelopathies

  • Integrated model of channel regulation:

    • Membrane depolarization triggers movement of the voltage sensor domain

    • This movement alters the position/conformation of the S4-S5 linker

    • The resulting conformational change releases inhibition of the activation gate

    • PIP2 binding further stabilizes the open conformation

These regulatory mechanisms have been studied using a combination of crystallography, mutagenesis, and electrophysiology. The opposing actions of S4S5L and PIP2 provide a sophisticated system for fine-tuning channel activity in response to both membrane potential and lipid composition . The mechanistic understanding of these regulatory elements has implications for understanding how disease-causing mutations affect channel function and for developing targeted therapeutics.

How do researchers distinguish between trafficking defects and functional defects in KCNQ1 mutants?

Distinguishing between trafficking and functional defects requires complementary methodological approaches:

  • Microscopy techniques:

    • Confocal microscopy with fluorescently tagged KCNQ1 to visualize subcellular localization

    • Co-localization with organelle markers (ER, Golgi, plasma membrane)

    • Live-cell imaging to track trafficking dynamics

  • Biochemical approaches:

    • Cell surface biotinylation to quantify membrane expression

    • Glycosylation analysis to determine maturation state

    • Western blotting with phospho-specific antibodies to assess post-translational modifications

  • Electrophysiological analysis:

    • Patch-clamp recordings to measure channel conductance

    • Analysis of voltage-dependence and kinetic parameters

    • Comparison of current density (normalized to cell capacitance) to distinguish between expression and function

  • Rescue experiments:

    • Low temperature incubation to distinguish folding vs. trafficking defects

    • Chemical chaperones (glycerol, DMSO) to assist protein folding

    • Trafficking enhancers (thapsigargin) to overcome ER retention

What is the role of KCNQ1 in non-cardiac tissues and how can it be studied in these contexts?

KCNQ1 has diverse physiological roles beyond cardiac function:

  • Inner ear function:

    • Essential for K+ homeostasis in the endolymph

    • Mutations cause deafness in Jervell and Lange-Nielsen syndrome

    • Study methods: Auditory brainstem responses, endocochlear potential measurements, cochlear morphology examination

  • Gastrointestinal system:

    • Regulates gastric acid secretion

    • Study methods: pH monitoring, secretion assays in organoid models

  • Endocrine system:

    • Involved in insulin secretion and glucose homeostasis

    • Study methods: Glucose tolerance tests, insulin secretion assays

  • Growth regulation:

    • Located in an imprinted gene cluster that affects growth

    • Loss-of-function mutations not associated with growth abnormalities, but maternal beta blocker use during pregnancy may affect growth

    • Study methods: Anthropometric measurements, growth curve analysis

  • Potential neurological functions:

    • Expression detected in multiple brain regions

    • Possible link to epilepsy and sudden unexplained death in epilepsy (SUDEP)

    • Study methods: EEG recordings, behavioral testing, tissue-specific knockout models

Research using gene therapy approaches in a mouse model of Jervell and Lange-Nielsen syndrome demonstrated that virally mediated KCNQ1 expression in cochlear marginal cells could prevent deafness . Treatment produced significant hearing preservation ranging from 20 dB improvement to complete correction of the deafness phenotype , highlighting the potential for tissue-specific interventions for KCNQ1-related disorders beyond cardiac arrhythmias.

What is the significance of KCNQ1 imprinting in developmental and physiological contexts?

KCNQ1 imprinting has significant developmental and physiological implications:

  • Genomic organization and imprinting control:

    • KCNQ1 is located within an imprinted gene cluster on chromosome 11p15.5

    • The KCNQ1 locus contains imprinting control region 2 (ICR2), which regulates nearby genes

    • Regulated by the long non-coding RNA KCNQ1ot1, which affects chromatin conformation

  • Tissue-specific imprinting patterns:

    • In most tissues, KCNQ1 shows maternal expression and paternal silencing

    • In the heart, imprinting is developmentally regulated with progressive activation of the paternal allele

    • KCNQ1ot1 shows biallelic expression specifically in the heart, unlike other tissues

  • Developmental consequences:

    • Mutations disrupting the imprinted region can cause growth disorders:

      • Beckwith-Wiedemann syndrome (characterized by overgrowth)

      • Silver-Russell syndrome

    • Maternal inheritance of KCNQ1 mutations and prenatal beta blocker exposure associated with reduced length at birth, with catch-up growth during the first year (Δ0.08 SDS/month, P = 0.004)

  • Research techniques for imprinting analysis:

    • Allele-specific RT-PCR using polymorphic markers

    • DNA methylation analysis at imprinting control regions

    • RNA/DNA FISH to visualize transcript localization

    • Chromatin immunoprecipitation to assess histone modifications

Studies in mouse models have shown that the reactivated maternal KCNQ1ot1 transcript in heart tissue associates with chromatin in cis, suggesting a direct regulatory mechanism . When KCNQ1ot1 is absent (in K-term mice), KCNQ1 levels increase significantly by E16.5, indicating that KCNQ1ot1 transcription plays a role in regulating KCNQ1 expression during heart development .

How can computational modeling be used to understand KCNQ1 channel dynamics and gating mechanisms?

Computational modeling provides powerful insights into KCNQ1 channel function:

  • Structural modeling approaches:

    • Homology modeling based on related potassium channels

    • Integration with experimental constraints from biophysical studies

    • Rosetta protein-protein docking for modeling channel-subunit interactions

  • Molecular dynamics (MD) simulations:

    • All-atom MD to study conformational dynamics of channel states

    • Examination of voltage sensor movement during gating

    • Analysis of ion permeation and selectivity mechanisms

    • Assessment of protein-lipid interactions, particularly with PIP2

  • Mathematical models of channel gating:

    • Markov models to capture state transitions during activation/inactivation

    • Integration with whole-cell electrophysiology data

    • Prediction of channel behavior under various conditions

  • Integration with experimental data:

    • Iterative refinement of models based on experimental results

    • Use of experimental restraints to guide computational modeling

    • Validation through structure-function studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.