Recombinant Mouse Potassium voltage-gated channel subfamily S member 1 (Kcns1)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Role

Recombinant Mouse Kcns1 (UniProt ID: O35173 ) is a 497-amino acid protein belonging to the delayed-rectifier potassium channel family. It modulates neuronal excitability by forming heterotetrameric complexes with Kv2 (Kcnb) subunits, altering their inactivation kinetics and stabilizing membrane repolarization . Unlike standalone Kv channels, Kcns1 requires co-assembly with Kv2 subunits to influence action potential propagation in sensory neurons .

Research Findings from Knockout Models

Studies using Kcns1-deficient mice revealed:

PhenotypeWild-TypeKcns1 KOImplications
Basal mechanical painNormal thresholdsIncreased sensitivity Kcns1 dampens mechanical nociception
Neuropathic pain (post-injury)Moderate hypersensitivityExaggerated mechanical/cold pain Kcns1 loss exacerbates chronic pain
Motor coordination (rotarod test)Standard performanceEnhanced performance Paradoxically improves proprioceptive signaling

These findings suggest Kcns1 regulates A-fiber nociceptors and low-threshold mechanoreceptors, primarily in myelinated sensory neurons .

Target for Chronic Pain Management

  • Mechanism: Restoring Kcns1 expression or activity could reduce hyperexcitability in Aβ/Aδ fibers .

  • Evidence: Kcns1 polymorphisms correlate with human chronic pain conditions (e.g., phantom limb pain) .

  • Strategy: Compounds enhancing Kv9.1/Kv2.1 heteromer activity may alleviate mechanical and cold allodynia .

Neurological Disorders

  • Epilepsy: Downregulation of potassium channels (including Kcns1) is linked to temporal lobe epilepsy .

  • Neuroprotection: Modulating Kv9.1 may stabilize neuronal networks in hyperexcitable states .

Challenges in Pharmacological Targeting

  • Subunit Dependency: Requires co-expression with Kv2 subunits for functional activity .

  • CNS vs. Peripheral Effects: Global Kcns1 deletion complicates distinguishing central vs. peripheral roles .

  • Tool Development: No selective agonists/antigens exist, necessitating transgenic models or siRNA approaches .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Kcns1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-497
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcns1
Target Protein Sequence
MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRLGRLQAAASEEQARRL CDDYDAAAHEFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFGQEADYWGLGENALATC CRARYLERRVARPRAWDEDSDAPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTME NPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSAEEVRDDPV LRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDQRG ASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVS VFSGVAYTAEEENEGFHTIPACWWWGTVSMTTVGYGDVVPETVGGKLAASGCILGGILVV ALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLSSVDGVSDVSLETSRDTSQEGRS TDLETQAPREPAKSHSY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2. This subunit modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Database Links

KEGG: mmu:16538

STRING: 10090.ENSMUSP00000038901

UniGene: Mm.6217

Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, but not in the other tissues tested. The highest levels of expression are in olfactory bulb, cerebral cortex, hippocampus, habenula, basolateral amygdaloid nuclei and cerebellum.

Q&A

What is the basic structure and function of mouse Kcns1?

Mouse Kcns1 (potassium voltage-gated channel subfamily S member 1) encodes the KNa1.1 channel, a sodium-activated potassium channel. The protein contains four exons, with the coding region restricted to exon 3. The channel functions as a delayed rectifier conductance that contributes to the resting membrane potential, afterhyperpolarization current, and action potential threshold . Structurally, Kcns1 requires heteromerization with members of the Kcnb (Kv2) superfamily to form functional channels, as it is non-conducting on its own . The C-terminal end region corresponding to amino acids 469-497 (NP_032461.2) has been identified as important for antibody recognition .

How does Kcns1 expression vary across neural tissues in mice?

Kcns1 shows a distinct expression pattern in the mouse nervous system. It is predominantly expressed in medium to large diameter neurons in the dorsal root ganglia (DRG), with approximately 40% of all DRG neurons showing Kcns1 immunoreactivity . Cell size distribution analysis reveals that 40.8% of medium and 69.2% of large diameter neurons express Kcns1, while expression in small nociceptive neurons is limited . In the central nervous system, Kcns1 is expressed in laminae III to V of the dorsal horn of the spinal cord (where most sensory A fibers terminate) and in large motoneurons of the ventral horn . It is also abundantly expressed in various brain regions but excluded from non-neuronal tissues such as muscle, heart, lung, kidney, and liver .

What neuronal subtypes primarily express Kcns1?

Kcns1 is primarily expressed in myelinated sensory neurons positive for neurofilament-200 (NF200), including Aδ-fiber nociceptors and low-threshold Aβ mechanoreceptors . The channel shows very limited overlap with markers of small nociceptive neurons such as calcitonin gene-related peptide (CGRP) and isolectin B4 (IB4), with the exception of some larger CGRP-positive neurons . This expression profile suggests that Kcns1 is enriched in myelinated A fibers, including both nociceptive (Aδ and a minority of Aβ) and non-nociceptive (Aβ low-threshold mechanoreceptors) afferents .

What techniques have been validated for generating Kcns1 knockout and knock-in mouse models?

Several approaches have been successfully employed to generate Kcns1 modified mouse models:

  • Conditional Knockout Models: Advillin-driven inducible transgenic mice have been generated by flanking exon 3 (which contains the entire coding region of Kcns1) with loxP sites, and crossing the resulting mouse line with AdvCreERT2 BAC transgenics . Deletion is induced by intraperitoneal injection of tamoxifen (75 mg/kg) for 5 consecutive days, with a minimum waiting period of 10 days before assessment .

  • CRISPR/Cas9 Knock-in Models: Point mutations have been introduced using CRISPR/Cas9 gene editing with a guide RNA targeting specific exons (e.g., exon 14 encoding the RCK1 domain) and homology-directed repair templates containing the desired mutation . Verification involves sequencing up to 1 kb in either direction to exclude concatameric insertion and confirming expression by real time-quantitative PCR .

  • Validation Approaches: Expression validation is typically performed using digital droplet PCR or real time-qPCR to identify each allele, as well as antibody staining to confirm protein expression patterns .

What electrophysiological methods are most effective for characterizing Kcns1 channel function?

For effective electrophysiological characterization of Kcns1 function, researchers have successfully employed:

  • Acute Slice Electrophysiology: This technique has been used to record from CA1 hippocampal pyramidal neurons and parvalbumin-expressing interneurons in brain slices from Kcns1 knock-in and wild-type mice . This approach allows for assessment of miniature inhibitory postsynaptic currents (mIPSCs) and neuronal firing properties in response to current injections .

  • Channel Activation Studies: Application of KNa1.1 channel activators such as loxapine to wild-type neurons can be used to recapitulate the effects of gain-of-function mutations, providing evidence for direct channel mechanisms .

  • Ex Vivo Recordings: This approach has proven valuable for assessing Kcnb/Kcns1 signaling in sensory neurons, particularly in the context of injury models .

  • Methodological Considerations: When designing electrophysiological experiments, it's important to consider that Kcns1 channels require physiological intracellular sodium concentrations for activation, and their function depends on microdomains of elevated sodium maintained by voltage-gated sodium channels and the sodium-potassium pump .

How should researchers validate antibodies for Kcns1 detection in immunohistochemistry?

A robust validation protocol for Kcns1 antibodies should include:

  • Epitope Selection: Antibodies targeting the C-terminal end region of mouse Kcns1 (amino acids 469-497, NP_032461.2) have proven effective . The C-terminal antibody is expected to bind to all isoforms present in permeabilized cells, as Kcns1 alternative splicing occurs with N-terminal exons .

  • Production Method: Generation of GST fusion proteins containing the target epitope, followed by affinity purification of the antibody, has been successfully employed .

  • Validation in Heterologous Expression Systems: Testing antibodies against HEK 293T cells transfected with Kcns1 with or without Kcns1 shRNA, followed by immunoblotting .

  • Knockout Controls: Comparing antibody staining in wild-type versus Kcns1 knockout tissues to confirm specificity .

  • Objective Quantification of Immunoreactivity: Signal quantification using software such as ImageJ, with cells considered positive only when the intensity of immunoreactivity is higher than 2× background + 2× standard error of the mean .

How does Kcns1 influence neuronal excitability and circuit function?

Kcns1 plays a complex role in regulating neuronal excitability:

  • Cell Type-Specific Effects: In parvalbumin-expressing (PV+) interneurons, Kcns1 gain-of-function mutations lead to failure to fire repetitively with large amplitude current injections and increased susceptibility to depolarization block . This suggests Kcns1 regulates the firing properties of inhibitory interneurons.

  • Synaptic Transmission Modulation: Kcns1 mutations can alter the amplitude of miniature inhibitory postsynaptic currents without affecting their frequency, indicating changes in inhibitory tone .

  • Action Potential Regulation: Physiological Kcns1 activity contributes to the regulation of action potentials during high-frequency stimulation by fine-tuning the frequency based on the level of channel activity .

  • Circuit-Level Impact: The differential effects of Kcns1 on excitatory versus inhibitory neurons can lead to complex network alterations. Evidence suggests that gain-of-function mutations may dampen interneuron excitability to a greater extent than pyramidal neuron excitability, potentially driving network hyperexcitability .

What is the evidence linking Kcns1 dysfunction to epilepsy in mouse models?

Several lines of evidence connect Kcns1 dysfunction to epilepsy:

  • Seizure Susceptibility in Knock-in Models: Heterozygous and homozygous Kcns1 knock-in mice carrying gain-of-function mutations display greater seizure susceptibility to chemoconvulsants such as kainate and pentylenetetrazole (PTZ), but interestingly, not to flurothyl .

  • Spontaneous Seizure Activity: Homozygous Kcns1 knock-in mice modeling the human p.Y796H variant exhibit spontaneous tonic and generalized tonic-clonic seizures, attributed primarily to reduced excitability of non-fast spiking GABAergic neurons and enhanced homotypic connectivity in both excitatory and inhibitory neurons .

  • Cellular Mechanism: Electrophysiological studies suggest that the epileptogenic effect of Kcns1 gain-of-function mutations stems from a preferential dampening of interneuron excitability compared to pyramidal neuron excitability, leading to network hyperexcitability .

  • Protective Effect of Kcns1 Deletion: Interestingly, Kcnt1 (another potassium channel) knockout mice exhibit lower seizure susceptibility than wild-type mice, along with deficits in spontaneous motor activity and learning ability . This contrasts with the effects of Kcns1 mutations, highlighting the complex roles of different potassium channels in neuronal excitability.

How does Kcns1 modulate pain processing in peripheral neurons?

Kcns1 plays an important role in pain processing through several mechanisms:

  • Basal Mechanical Pain Sensitivity: Mice with Kcns1 deletion in peripheral sensory neurons show a modest increase in basal mechanical pain sensitivity, suggesting a pain-protective role for Kcns1 under normal conditions .

  • Neuropathic Pain Modulation: Following neuropathic injury, Kcns1 knockout mice exhibit exaggerated mechanical pain responses and hypersensitivity to both noxious and innocuous cold, consistent with increased A-fiber activity .

  • Expression Changes Following Injury: In sensory nerves, Kcns1 mRNA is dramatically and rapidly downregulated by nerve injury, with a time course that matches the development of pain phenotypes .

  • Proprioceptive Function: Interestingly, Kcns1 deletion also improves locomotor performance in the rotarod test, suggesting enhanced proprioceptive signaling .

  • Cellular Mechanism: The pain-modulatory effects of Kcns1 appear to be mediated through its role in stabilizing currents and promoting closed-state inactivation that attenuates excitability when heteromerized with Kcnb (Kv2) family members .

What bioinformatic approaches can identify Kcns1-related genes in temporal lobe epilepsy?

Advanced bioinformatic approaches for identifying Kcns1-related genes in temporal lobe epilepsy include:

  • Weighted Gene Co-expression Network Analysis (WGCNA): This technique has been used to analyze transcriptome data from normal and epileptic neocortex samples, identifying modules of co-expressed genes and their associations with clinical characteristics .

  • Pathway Extraction from Molecular Signatures Database: Researchers have extracted potassium channel-related genes by referring to pathways such as GOMF_POTASSIUM_CHANNEL_ACTIVITY, GOMF_POTASSIUM_CHANNEL_INHIBITOR_ACTIVITY, and GOMF_POTASSIUM_CHANNEL_REGULATOR_ACTIVITY .

  • Single-Cell RNA Sequencing Analysis: Analysis of scRNA-seq data allows for the identification of cell type-specific expression patterns of Kcns1 and related genes in epileptic tissues .

  • Module Identification Using Dynamic Tree-Cutting: This method can identify modules of co-expressed genes (with at least 30 genes per module) and merge similar modules using a threshold of 0.2 .

  • Correlation Analysis with Clinical Characteristics: The associations between identified gene modules and clinical characteristics can be analyzed using Pearson correlation coefficients to identify the most relevant modules for further study .

What are the key considerations for designing cell-type specific Kcns1 manipulation experiments?

When designing cell-type specific Kcns1 manipulation experiments, researchers should consider:

  • Cre-Driver Line Selection: Choose appropriate Cre-driver lines that target the specific neuronal populations of interest. For example, using Advillin-Cre for sensory neurons or PV-Cre for parvalbumin-positive interneurons .

  • Temporal Control Systems: Implement inducible systems (e.g., CreERT2) to control the timing of Kcns1 manipulation, allowing for developmental compensation to be minimized .

  • Knock-in Strategy for Point Mutations: When introducing specific mutations, ensure the design includes:

    • Appropriate guide RNAs targeting the relevant exon

    • Homology-directed repair templates with the desired mutation

    • Verification of the mutation by sequencing

    • Confirmation of transcript expression by qPCR

  • Reporter Systems for Visualization: Consider breeding Kcns1 mutant mice to reporter lines (e.g., parvalbumin-tdTomato) to facilitate visualization and recording from specific cell populations .

  • Control for Compensation Mechanisms: Design experiments to account for potential compensatory upregulation of other potassium channels, which may mask phenotypes in chronic knockout models .

What are the most promising approaches for developing Kcns1-targeted therapeutics?

Based on current research, promising approaches for developing Kcns1-targeted therapeutics include:

  • Channel Activators: Compounds that enhance Kcns1 activity may provide analgesia, particularly for neuropathic pain conditions . Existing compounds like loxapine have been shown to activate KNa1.1 channels and could serve as starting points for drug development .

  • Drug Repurposing via Database Mining: The DrugBank database can be used to identify existing drugs that target Kcns1 and related potassium channel genes, providing candidates for repositioning as anti-epilepsy or analgesic treatments .

  • Cell Type-Specific Delivery Systems: Development of methods to target drugs specifically to neuronal subtypes expressing Kcns1, such as myelinated sensory neurons or inhibitory interneurons, could improve efficacy while reducing side effects .

  • Gene Therapy Approaches: For gain-of-function mutations associated with epilepsy, antisense oligonucleotides or RNA interference strategies could potentially reduce the expression of mutant Kcns1 .

  • Heteromerization Partners as Targets: Since Kcns1 function depends on heteromerization with Kcnb (Kv2) family members, targeting these interactions or the partner channels themselves may provide an alternative therapeutic strategy .

How can researchers optimize detection of low-abundance Kcns1 expression?

Optimizing detection of low-abundance Kcns1 expression requires careful attention to:

  • Tissue Preparation:

    • For immunohistochemistry: Perfusion fixation with 4% paraformaldehyde followed by post-fixation for 1-2 hours provides optimal preservation of Kcns1 antigens .

    • For RNA analysis: Quick tissue harvesting and immediate freezing in liquid nitrogen minimizes RNA degradation.

  • Antibody Selection and Validation:

    • Use antibodies directed against the C-terminal end region of mouse Kcns1, which can detect all isoforms present in permeabilized cells .

    • Validate antibody specificity using knockout controls and heterologous expression systems .

  • Signal Amplification Techniques:

    • Employ tyramide signal amplification or similar methods to enhance detection of low-abundance signals.

    • Use Alexa-488 and 594-conjugated secondary antibodies (1:1000 dilution) with appropriate incubation times (1 hour at room temperature) .

  • Imaging Optimization:

    • Capture images on a confocal microscope (e.g., Fluoview FV1000; Olympus) to improve signal-to-noise ratio .

    • Use consistent exposure settings across all samples to allow for quantitative comparison .

  • Quantification Methods:

    • Implement objective criteria for positive signal identification, such as signal intensity > 2× background + 2× SEM .

    • Measure 100-200 DRG neurons and 50-100 motoneurons per animal for robust quantification .

What are the key challenges in interpreting Kcns1 knockout phenotypes?

Interpreting Kcns1 knockout phenotypes presents several challenges that researchers should consider:

  • Compensatory Mechanisms: Loss of Kcns1 may lead to compensatory upregulation of other potassium channels, potentially masking phenotypes. Inducible knockout systems can help minimize this effect .

  • Tissue-Specific Effects: As Kcns1 is expressed in both central and peripheral neurons, global knockout phenotypes may result from complex interactions across different tissues. Using conditional knockouts (e.g., peripheral neuron-specific) helps isolate specific contributions .

  • Heteromerization Dependencies: Since Kcns1 functions by heteromerizing with Kcnb family members, its loss may have different effects depending on the expression patterns of these partners across various cell types .

  • Baseline Differences in Pain Sensitivity: Strain differences in baseline pain sensitivity can complicate interpretation of pain phenotypes. Using proper control littermates is essential for accurate assessment .

  • Developmental Considerations: Kcns1 may play different roles during development versus adulthood. Researchers should consider whether observed phenotypes reflect developmental or acute functional requirements of the channel .

How might single-cell transcriptomics advance our understanding of Kcns1 function?

Single-cell transcriptomics offers several promising avenues for advancing Kcns1 research:

  • Neuronal Subtype Identification: Single-cell RNA sequencing can precisely identify the neuronal subtypes expressing Kcns1, potentially revealing previously unknown cell populations where the channel plays important roles .

  • Co-expression Networks: Analysis of co-expression patterns at the single-cell level can identify genes that are consistently co-regulated with Kcns1, suggesting functional relationships or shared regulatory mechanisms .

  • Disease-Associated Cell States: In models of epilepsy or neuropathic pain, single-cell transcriptomics can reveal how Kcns1 expression changes in specific cell types during disease progression, potentially identifying cell populations most affected by Kcns1 dysfunction .

  • Developmental Trajectory Analysis: This approach can track changes in Kcns1 expression during neuronal maturation, providing insights into its developmental roles .

  • Spatial Transcriptomics Integration: Combining single-cell RNA-seq with spatial information can map Kcns1-expressing cells within complex tissues like the brain, revealing potential circuit-level implications of Kcns1 function .

What are the implications of Kcns1's role for developing novel analgesic approaches?

The unique properties of Kcns1 suggest several promising directions for analgesic development:

  • A-Fiber Targeted Therapies: Given Kcns1's predominant expression in myelinated A fibers, compounds that enhance its activity could specifically target mechanical and cold pain transmitted by these fibers while sparing other sensory modalities .

  • Neuropathic Pain Specificity: Since Kcns1 is downregulated after nerve injury with a time course matching pain development, therapies that restore its function or expression might specifically address neuropathic pain conditions .

  • Dual Effects on Pain and Proprioception: The finding that Kcns1 deletion improves locomotor performance while increasing pain sensitivity suggests potential for developing therapeutics with beneficial effects on both sensory and motor function .

  • Prevention Strategies: Compounds that prevent Kcns1 downregulation after injury might serve as preventive treatments for neuropathic pain development .

  • Personalized Medicine Approaches: Given the genetic associations between KCNS1 variants and pain sensitivity in humans, genetic screening might identify individuals most likely to benefit from Kcns1-targeted therapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.