Recombinant Mouse Potassium voltage-gated channel subfamily S member 3 (Kcns3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcns3; Potassium voltage-gated channel subfamily S member 3; Voltage-gated potassium channel subunit Kv9.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcns3
Target Protein Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY SVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR YQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDEHKSSLTSIPIC WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDME VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY NTASLENCTGK
Uniprot No.

Target Background

Function
Potassium channel subunit that does not independently form functional channels. It forms functional heterotetrameric channels with KCNB1, modulating the activation and deactivation rates of KCNB1's delayed rectifier voltage-gated potassium channels. Heterotetrameric channels formed with KCNB1 exhibit increased current amplitude and a negative shift in the action potential activation threshold in hypoxic pulmonary artery smooth muscle cells.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.3/KCNS3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Kcns3 and what is its significance in neuronal function?

Kcns3 encodes the Kv9.3 subunits that are selectively expressed in parvalbumin-positive (PV) neurons in the cortex. These neurons exhibit a distinctive fast spiking (FS) phenotype that depends on multiple voltage-gated potassium channels (Kv). The selective expression pattern of Kcns3 in PV neurons strongly suggests it plays a critical role in maintaining the FS phenotype . Dysfunction of Kcns3 has been implicated in neuropsychiatric disorders, as KCNS3 expression is lower in PV neurons in the neocortex of subjects with schizophrenia .

What experimental models are available for studying Kcns3 function?

Researchers typically employ Kcns3-deficient mouse models, including wild-type (Kcns3+/+), heterozygous (Kcns3neo/+), and homozygous knockout (Kcns3neo/neo) mice . These models allow for comparative studies investigating how various levels of Kcns3 expression affect PV neuron physiology. The research approaches typically combine gene expression analyses, computational modeling, and electrophysiological recordings in acute cortical slices to comprehensively assess Kv9.3 subunit function .

What methods are optimal for detecting and quantifying Kcns3 expression?

Real-time PCR represents the standard approach for quantifying Kcns3 mRNA levels. According to established protocols, researchers should:

  • Extract total RNA using TRIzol reagent followed by RNeasy lipid tissue mini kit

  • Convert RNA to cDNA using High Capacity RNA-to-cDNA Kit

  • Amplify target genes with Power SYBR Green PCR Master Mix using a real-time PCR system

  • Normalize expression using internal control transcripts such as β-actin (Actb), cyclophilin A (Ppia), and glyceraldehyde-3-phosphate dehydrogenase (Gapdh)

The table below details primer sets that have been validated for Kcns3 research:

mRNA (GenBank accession)Primer setLocationProduct
Kcns3 (NM_173417)F: ACCAAGGAAGAAGAGAGTGAGG
R: AGAGACCGAAGCCCTACAGA
1258–1376119 bp
Pvalb (NM_013645)F: CAGACTCCTTCGACCACAAA
R: GCCACTTTTGTCTTTGTCCA
87–193107 bp
Actb (NM_007393)F: CCTCTATGCCAACACAGTGC
R: TGCTAGGAGCCAGAGCAGTA
955–104995 bp
Ppia (NM_008907)F: CTGCACTGCCAAGACTGAAT
R: CCTTCTTTCACCTTCCCAAA
383–44563 bp

All primer sets should amplify specific, single products with expected sizes and have amplification efficiency ≥96% for reliable results .

How should researchers approach in situ hybridization for Kcns3 detection?

For cellular localization studies, dual-label in situ hybridization represents the gold standard approach for detecting Kcns3 mRNA in specific neuronal populations. The recommended protocol includes:

  • Preparation of 35S-labeled riboprobes for Kcns3 mRNA and DIG-labeled riboprobes for Pvalb mRNA

  • Fixation of tissue sections with 4% paraformaldehyde in PBS

  • Acetylation with 0.25% acetic anhydrate and dehydration through a graded ethanol series

  • Hybridization with 35S-labeled riboprobes (2 × 107 dpm/ml) for Kcns3 and DIG-labeled riboprobe (100 ng/ml) for Pvalb

  • Detection using anti-DIG antibody conjugated with alkaline phosphatase and NTB emulsion

This approach allows visualization of Kcns3 expression specifically within PV neurons, providing crucial spatial information about expression patterns across different brain regions.

How does Kcns3 deficiency affect the electrophysiological properties of PV neurons?

Kcns3 deficiency disrupts the normal physiology of parvalbumin neurons in the mouse prefrontal cortex, altering their characteristic fast-spiking properties . The effects are complex because hyperpolarizing Kv currents (like those involving Kv9.3 subunits) can paradoxically facilitate repetitive action potential firing rather than simply reducing excitability .

The exact mechanisms underlying this phenomenon likely involve precise regulation of action potential repolarization, affecting firing frequency, precision, and sustainability during prolonged activity. Researchers should employ patch-clamp electrophysiology in acute brain slices from Kcns3 knockout models to characterize these alterations in detail, measuring parameters such as action potential threshold, afterhyperpolarization amplitude, and maximum sustained firing rates.

What is the relationship between Kcns3 and other potassium channel genes in regulating neuronal excitability?

Kcns3 does not function in isolation but rather as part of a complex network of potassium channels that collectively determine neuronal excitability. Research indicates potential functional interactions between Kcns3 and other channel genes like Kcnb1 . To investigate these relationships, researchers should employ dual-label in situ hybridization techniques to simultaneously detect multiple channel transcripts within the same neurons.

Computational modeling approaches can then integrate this expression data to predict how different combinations and ratios of channel proteins might affect neuronal firing patterns. These models should account for the potential formation of heteromeric channels, which could exhibit properties distinct from homomeric configurations.

How can computational modeling enhance our understanding of Kcns3's role in neuronal circuit function?

Computational modeling represents a powerful approach for understanding how Kcns3-encoded channels influence both individual neuronal properties and network dynamics. Models should integrate:

  • Detailed biophysical properties of Kv9.3 channels (activation/inactivation kinetics, voltage-dependence)

  • Cell-specific expression patterns determined from experimental data

  • Known network connectivity of PV interneurons

  • Realistic synaptic properties and transmission dynamics

Such models can help predict whether Kcns3 downregulation (as observed in schizophrenia) would tend to increase PV neuron firing or disrupt their capacity for sustained high-frequency firing . This approach provides testable hypotheses that can guide subsequent experimental investigations.

What quality control measures should be implemented when working with Kcns3 knockout models?

When working with Kcns3 knockout models, researchers should implement rigorous quality control measures:

  • Genotyping: Confirm genotype status (wild-type, heterozygous, homozygous) using validated PCR protocols before experiments

  • Expression verification: Quantify Kcns3 expression levels using qPCR to confirm the degree of knockdown

  • Normalization controls: Include internal control transcripts (Actb, Ppia, Gapdh) for accurate data normalization

  • Specificity controls: Use sense riboprobes as negative controls for in situ hybridization experiments to assess background signal

  • Replication with multiple animals: Use sufficient biological replicates (n ≥ 5 per genotype) to account for individual variability

  • Age and sex matching: Control for age and sex effects by using appropriately matched experimental groups

These measures ensure experimental rigor and reproducibility when investigating Kcns3 function.

How should researchers interpret changes in Kcns3 expression in relation to PV neuron function?

Interpreting changes in Kcns3 expression requires careful consideration of its complex role in neuronal physiology. Researchers should consider two potential interpretations:

  • If Kv9.3 subunits primarily produce hyperpolarizing currents that decrease neuronal excitability, then Kcns3 downregulation might increase PV neuron firing as a homeostatic response to restore activity in a hypoactive network.

  • Alternatively, if Kv9.3 channels facilitate repetitive action potential firing, then Kcns3 downregulation might disrupt the capacity of PV neurons to fire repetitively .

To differentiate between these possibilities, researchers should correlate Kcns3 expression levels with multiple electrophysiological parameters, including firing threshold, action potential half-width, maximum firing frequency, and firing sustainability under prolonged stimulation.

What are the implications of Kcns3 dysfunction for neuropsychiatric disorders?

The reduced expression of KCNS3 in PV neurons in schizophrenia suggests potential therapeutic relevance for this channel . Understanding whether this reduction represents a primary pathological mechanism or a compensatory response is crucial for developing targeted interventions. If Kcns3 downregulation disrupts the fast-spiking properties of PV neurons, pharmacological strategies to enhance remaining channel function could be beneficial.

Researchers should investigate correlations between Kcns3 expression levels and cognitive function in animal models, particularly focusing on working memory and cognitive flexibility tasks that are impaired in schizophrenia. Similar approaches might be relevant for other disorders involving PV neuron dysfunction, such as autism spectrum disorders and epilepsy.

How might targeting Kcns3 therapeutically affect neural circuit function?

Developing therapeutic approaches targeting Kcns3 requires understanding its effects on network dynamics. Researchers should investigate:

  • How Kcns3 modulation affects gamma oscillations, which depend on PV neuron function and are disrupted in schizophrenia

  • Whether Kcns3 enhancement could restore normal PV neuron function in disease models

  • Potential off-target effects, given that manipulating ion channel function can have widespread consequences

These studies would benefit from combining optogenetic approaches with electrophysiological recordings in behaving animals to establish causal relationships between Kcns3 function, neural synchrony, and cognitive performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.