Recombinant Mouse Potassium voltage-gated channel subfamily V member 1 (Kcnv1)

Shipped with Ice Packs
In Stock

Description

Structure and Classification

Potassium voltage-gated channel subfamily V member 1 (Kcnv1), also known as Kv8.1, belongs to the electrically silent KvS (silent Kv) subunit class of potassium channels. In mice, the Kcnv1 protein consists of 503 amino acids and possesses a structure typical of voltage-activated potassium channels with six transmembrane domains . Like other potassium channels, Kcnv1 has a pore-forming region, but unlike conventional potassium channels, it cannot form functional homomeric channels . This distinctive characteristic classifies it as a "silent" potassium channel subunit.

Gene and Protein Information

The mouse Kcnv1 gene encodes a protein of 503 amino acids that shares significant homology with human KCNV1, which consists of 500 amino acids and has six transmembrane domains . This high degree of conservation across species underscores the evolutionary importance of this protein in neurophysiology. The protein belongs to the potassium channel family, specifically to the V (KvS) subfamily, a classification that reflects its unique functional characteristics that distinguish it from other potassium channel subunits .

Kcnv1 is primarily expressed in the brain, suggesting tissue-specific roles in neuronal function and regulation . This restricted expression pattern provides valuable insights into its potential physiological functions and makes it an intriguing target for neurophysiological research and potential therapeutic interventions targeting specific neurological conditions.

PropertyDescription
Protein NamePotassium voltage-gated channel subfamily V member 1
Gene NameKcnv1
AliasesVoltage-gated potassium channel subunit Kv8.1
OrganismMus musculus (Mouse)
Length (aa)503 amino acids
Transmembrane Domains6
Functional StatusElectrically silent (cannot form functional homomeric channels)

Role as a Silent Potassium Channel

A defining feature of Kcnv1 is its status as a "silent" potassium channel subunit. Despite having the structure typical of voltage-activated potassium channels, Kcnv1 cannot form functional homomeric channels . This electrical silence is a crucial aspect of its biology and distinguishes it from conventional potassium channels that can operate independently.

Instead of functioning autonomously, Kcnv1 exerts its influence by forming heteromeric complexes with other potassium channel subunits, particularly those from the Kv2 family . These heteromeric Kv2/KvS channels possess unique biophysical properties and display more tissue-specific expression patterns compared to homomeric channels, making them potentially valuable targets for pharmacological interventions and therapeutic approaches .

Modulation of Other Potassium Channels

Kcnv1's primary function appears to be the modulation of other potassium channels, particularly KCNB1 (Kv2.1) and KCNB2 (Kv2.2). When Kcnv1 combines with these channels to form heteromeric complexes, it significantly alters their functional properties . Specifically, Kcnv1 modulates these channels by shifting the threshold for inactivation to more negative values and slowing the rate of inactivation, thereby influencing their electrophysiological characteristics and ultimately affecting neuronal signaling.

In addition to its effects on inactivation kinetics, Kcnv1 can downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, possibly by trapping them in intracellular membranes . This regulatory function allows Kcnv1 to influence neuronal signaling without directly conducting potassium ions itself, representing a unique mechanism of channel regulation that contributes to the fine-tuning of neuronal excitability and function.

Target ChannelModulation Effect
KCNB1 (Kv2.1)Shifts inactivation threshold to more negative values; slows inactivation rate
KCNB2 (Kv2.2)Shifts inactivation threshold to more negative values; slows inactivation rate
KCNC4Down-regulates channel activity
KCND1Down-regulates channel activity

Expression Patterns

Kcnv1 expression is primarily limited to the brain , suggesting specialized roles in neuronal function and regulation. This tissue-specific expression pattern contributes to the unique properties of Kv2/KvS heteromeric channels in neuronal tissues and provides valuable insights into their potential physiological functions. The restricted expression of Kcnv1 in the brain also offers opportunities for targeted therapeutic interventions that could potentially modulate specific neuronal populations without affecting other tissues.

Within the brain, understanding the specific distribution of Kcnv1 across different regions and cell types could provide further insights into its physiological roles. While detailed information about the regional and cellular distribution of mouse Kcnv1 is limited in the available literature, its brain-specific expression pattern underscores its importance in neuronal function and highlights the need for further research in this area.

Recombinant Protein Technology

Recombinant protein technology allows for the production of specific proteins, including mouse Kcnv1, for research and therapeutic applications. Recombinant mouse Kcnv1 refers to the artificially produced Kcnv1 protein derived from the mouse genome, typically expressed in host systems such as bacteria, yeast, insect cells, or mammalian cells.

The production of recombinant mouse Kcnv1 typically involves cloning the mouse Kcnv1 gene into an expression vector, transforming or transfecting the vector into an appropriate host system, inducing protein expression, purifying the recombinant protein, and validating protein identity and functionality. This process allows researchers to obtain significant quantities of the protein for various experimental applications, including structural studies, functional analyses, and drug screening.

Recombinant mouse Kcnv1 may be produced with various modifications, such as fusion tags (His, GST, etc.) for purification and detection, or specific mutations to study structure-function relationships. These modifications facilitate purification and detection of the protein while potentially allowing researchers to investigate various aspects of Kcnv1 biology, including protein-protein interactions, modulation of channel properties, and potential roles in neurophysiology and pathology.

Applications in Research

Recombinant mouse Kcnv1 serves as a valuable tool for investigating potassium channel biology, neuronal function, and potential therapeutic targets. Key applications include studying the biophysical properties of Kv2/KvS heteromeric channels, investigating protein-protein interactions between Kcnv1 and other channel subunits, and developing and screening potential therapeutic compounds targeting Kcnv1 or its interactions.

Additionally, recombinant Kcnv1 can be used for generating antibodies for detection and localization of native Kcnv1 in tissues and cells, and for creating in vitro models to study the roles of Kcnv1 in neuronal function and pathology. The ability to produce and manipulate recombinant Kcnv1 provides researchers with powerful tools to advance our understanding of potassium channel biology and may lead to novel insights into neurological disorders associated with Kcnv1 dysfunction.

Impact on Neuronal Excitability

Interestingly, despite its ability to modulate potassium channels that regulate neuronal excitability, studies have shown that KCNV1 knockout does not significantly alter spontaneous action potential firing in motor neurons . This finding, based on multi-electrode array (MEA) recordings, suggests that Kcnv1's role in neuronal function extends beyond direct regulation of electrical signaling and may involve more complex mechanisms related to cellular homeostasis and metabolism.

The absence of changes in neuronal excitability following KCNV1 knockout may indicate that compensatory mechanisms exist to maintain normal electrical activity, or that Kcnv1's primary functions involve other aspects of neuronal physiology. Alternatively, the effects on excitability might be subtle or context-dependent, becoming apparent only under specific conditions or in specific neuronal populations. These possibilities highlight the complexity of Kcnv1's role in neuronal function and warrant further investigation.

Role in Cell Survival and Death

While Kcnv1 may not directly affect neuronal excitability, research has revealed its significant role in cell survival. Studies have shown that KCNV1 knockout or knockdown increases the vulnerability of motor neurons to cell death induced by proteasome inhibition (MG132 treatment), which promotes protein aggregation . This finding suggests that Kcnv1 plays a protective role in neurons, potentially by influencing cellular processes related to protein homeostasis and stress responses.

Specifically, compared to control motor neurons, KCNV1 knockout motor neurons exhibited higher rates of cell death following MG132 exposure . Similarly, knockdown of KCNV1 in healthy motor neurons using shRNAs increased their vulnerability to MG132-induced cell death . These observations highlight the importance of Kcnv1 in maintaining neuronal viability under stress conditions and suggest potential implications for neurodegenerative disorders characterized by protein aggregation and cellular stress.

Transcriptomic analysis of KCNV1 knockdown motor neurons revealed significant changes in gene expression, particularly in pathways related to lipid metabolism, protein translation, and membrane transport . Gene sets associated with the endoplasmic reticulum membrane, metabolism, and catabolism were downregulated, while those related to neuron projection and intracellular transport were upregulated . These changes in gene expression may underlie the increased vulnerability to cell death observed in the absence of Kcnv1 and provide valuable insights into the molecular mechanisms through which Kcnv1 contributes to neuronal survival.

Protein-Protein Interactions

The primary functional role of Kcnv1 involves its interactions with other potassium channel subunits, particularly those from the Kv2 family. These interactions lead to the formation of heteromeric channels with unique properties that cannot be achieved by either subunit alone . By forming heteromeric complexes with Kv2 subunits, Kcnv1 modulates their gating properties and influences their cellular localization and function, thereby affecting neuronal signaling in a manner that cannot be achieved by homomeric channels.

Key interaction partners of Kcnv1 include KCNB1 (Kv2.1) and KCNB2 (Kv2.2), which Kcnv1 modulates by shifting the threshold for inactivation and slowing the inactivation rate . Additionally, Kcnv1 can down-regulate the channel activity of KCNC4 and KCND1, further expanding its regulatory repertoire . The functional significance of these interactions lies in their ability to fine-tune neuronal signaling, potentially allowing for more precise regulation of electrical activity in specific neuronal populations.

Functional Partners

Beyond its direct interactions with potassium channel subunits, Kcnv1 has been associated with several other proteins that may contribute to its broader functional roles. According to STRING database analysis, potential functional partners of mouse Kcnv1 include Fau (Ubiquitin-like protein FUBI), Kcnab3 (Voltage-gated potassium channel subunit beta-3), Kcnab1 (Voltage-gated potassium channel subunit beta-1), and Kcnab2 (Voltage-gated potassium channel subunit beta-2) .

ProteinDescriptionInteraction Score
FauUbiquitin-like protein FUBI0.877
Kcnab3Voltage-gated potassium channel subunit beta-30.780
Kcnab1Voltage-gated potassium channel subunit beta-10.764
Kcnab2Voltage-gated potassium channel subunit beta-2Not specified

These interactions suggest that Kcnv1 may participate in broader regulatory networks beyond direct channel modulation, potentially influencing neuronal function through multiple mechanisms. For instance, Kcnab2 contributes to the regulation of nerve signaling and prevents neuronal hyperexcitability , suggesting that its interaction with Kcnv1 may be part of a larger regulatory network controlling neuronal function. Understanding these complex interaction networks could provide valuable insights into Kcnv1's role in neurophysiology and potential implications for neurological disorders.

Associations with Neurological Disorders

The role of Kcnv1 in neuronal function and survival suggests potential implications for neurological disorders. In humans, common variations in KCNV1 have been reported to be associated with schizophrenia , indicating a possible role in psychiatric conditions. This association highlights the potential importance of Kcnv1 in maintaining normal brain function and suggests that alterations in its expression or function could contribute to the pathophysiology of certain neuropsychiatric disorders.

Transcriptomic analysis of KCNV1 knockdown motor neurons revealed alterations in several genes associated with amyotrophic lateral sclerosis (ALS), including NEK1, OPTN, and STMN2 . These findings suggest that Kcnv1 dysfunction may contribute to or exacerbate neurodegenerative processes in conditions like ALS. Additionally, changes in genes related to proteostasis regulation and vesicle-associated membrane proteins suggest potential roles in protein aggregation and membrane trafficking, processes often disrupted in neurodegenerative diseases.

The increased vulnerability to cell death observed in the absence of Kcnv1 further supports its potential role in neuroprotection. Disruption of this protective function could contribute to neuronal loss in various pathological conditions, making Kcnv1 a potential target for neuroprotective strategies. Understanding the mechanisms underlying this protective effect could lead to novel therapeutic approaches for neurodegenerative disorders characterized by neuronal loss and dysfunction.

Potential Therapeutic Targets

The unique properties of Kcnv1 and its heteromeric channels make them potentially valuable targets for therapeutic interventions. Specifically, the tissue-specific expression of Kcnv1 in the brain and the distinct properties of Kv2/KvS heteromeric channels provide opportunities for targeted modulation of neuronal function without affecting other tissues . This specificity is particularly valuable for developing treatments for neurological disorders, as it could potentially reduce side effects associated with broader-acting compounds.

Potential therapeutic approaches involving Kcnv1 include modulating its expression or function to enhance neuroprotection, targeting specific Kv2/KvS interactions to influence channel properties, and developing compounds that mimic the modulatory effects of Kcnv1 on target channels. Additionally, Kcnv1 could serve as a biomarker for certain neurological conditions, and gene therapy approaches could potentially restore Kcnv1 function in cases of dysfunction.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly include your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery details, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
Kcnv1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnv1
Target Protein Sequence
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQAL SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ HESEQDFSKGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL NLQLLEILEYVCISWFTGEFVLRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM EMLRLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It modulates the activity of KCNB1 and KCNB2 channels by shifting the inactivation threshold to more negative values and slowing the inactivation rate. It can down-regulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by trapping them within intracellular membranes.
Database Links
Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.