Recombinant Mouse PQ-loop repeat-containing protein 1 (Pqlc1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Optimization

Recombinant mouse PQLC1 is optimized for high-yield production in prokaryotic systems. Key parameters include:

  • Host Strain: E. coli BL21 (DE3) or TB medium for enhanced expression .

  • Induction Conditions: 0.25 mM IPTG at 15°C for 24 hours .

  • Purification: Use of 2% sarkosyl buffer improves yield and purity .

Table 2: Critical Parameters for Recombinant PQLC1 Production

ParameterOptimal ConditionImpact on Yield/Purity
Cultivation Temperature15°CReduces misfolding
IPTG Concentration0.25 mMBalances expression vs. toxicity
Purification Buffer2% SarkosylEnhances solubility

Applications in Research

Recombinant mouse PQLC1 is utilized in:

  • Immunological Studies: ELISA kits detect anti-PQLC1 antibodies in serum .

  • Structural Analysis: Purified protein enables cryo-EM or X-ray crystallography studies .

  • Therapeutic Development: Serves as a target for antibodies or small molecules in cancer research .

Table 3: Applications and Tools

ApplicationExample ToolsSource
Antibody DevelopmentPolyclonal and monoclonal antibodies
Immune Response TestingFreund’s adjuvant-based immunization
Assay KitsCLIA and ELISA kits

Interacting Partners and Pathways

PQLC1 interacts with proteins involved in:

  • Metabolic Regulation: ADH5 (alcohol dehydrogenase) .

  • Transport Complexes: Potential homology to PQLC2’s interaction with WDR41 .

Challenges and Future Directions

  • Functional Elucidation: Direct studies on mouse PQLC1’s role in transport or signaling are needed.

  • Therapeutic Potential: Exploration of PQLC1 as a biomarker or drug target in lysosomal disorders or cancer.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc66a2; Pqlc1; Solute carrier family 66 member 2; PQ-loop repeat-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pqlc1
Target Protein Sequence
MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVA NILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNIKRRSFAATDSKDEE LRVPPRRPYLDFDPHHFWHWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVL TEAMLGVPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMV DLVILGQAYAFAHHPQKPAAHAVHPASTKAL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of mouse Pqlc1?

Pqlc1 belongs to the PQ-loop family of proteins characterized by the presence of internal repeats of PQ motifs. While specific research on mouse Pqlc1 is limited, insights can be drawn from studies on related proteins. Similar to PQBP1, which contains a PRD (residues 104-163) with hepta- and di-amino acid repeats, Pqlc1 likely contains structured domains that facilitate specific interactions with other cellular components . Most PQ-loop proteins function as membrane transporters, with Pqlc1 potentially playing roles in lysosomal transport mechanisms.

How does Pqlc1 expression vary across mouse tissues?

Pqlc1 shows differential expression patterns across mouse tissues, with notable expression in neuronal tissues, liver, and kidney. Expression analysis techniques such as qRT-PCR and Western blotting can be employed to quantify tissue-specific expression levels. Similar to PQBP1, which is crucial for the development of cognitive functions and hippocampal neurogenesis, Pqlc1 may exhibit tissue-specific functions that correlate with its expression patterns .

What are the recommended methods for detecting mouse Pqlc1 protein in tissue samples?

For optimal detection of mouse Pqlc1 in tissue samples, researchers should consider:

  • Western blotting using validated anti-Pqlc1 antibodies (recommended dilution 1:1000)

  • Immunohistochemistry for tissue localization (use 4% paraformaldehyde fixation)

  • Mass spectrometry for protein identification and quantification

When isolating the protein, similar approaches to those used for Plk1 purification can be adapted - using affinity chromatography followed by gel-filtration chromatography for optimal purity .

What expression systems are most effective for producing recombinant mouse Pqlc1?

Based on successful protocols for related proteins, the following expression systems are recommended for mouse Pqlc1:

  • Bacterial Expression System (E. coli):

    • Use BL21(DE3) strain with pET or pGEX vectors

    • Induce expression with 0.5 mM IPTG at 18°C for 16-18 hours

    • Note: May require optimization due to potential membrane protein properties

  • Insect Cell Expression System (Sf9 or Hi5 cells):

    • Similar to the approach used for Plk1, where the cDNA sequence is amplified by PCR and cloned into a pFastBac vector to generate recombinant baculovirus

    • Results in higher protein folding quality

    • Recommended for functional studies

  • Mammalian Expression System (HEK293 or CHO cells):

    • Optimal for post-translational modifications

    • Use pcDNA3.1 vector with CMV promoter

The choice depends on downstream applications, with bacterial systems suitable for structural studies and mammalian systems for functional characterization.

What purification strategies maximize yield and activity of recombinant mouse Pqlc1?

For optimal purification of recombinant mouse Pqlc1:

  • For His-tagged constructs:

    • Use Ni²⁺-NTA affinity chromatography with 20 mM imidazole in wash buffer and 250 mM imidazole for elution

    • Follow with size-exclusion chromatography using Superdex 200 column

  • For GST-tagged constructs:

    • Employ glutathione-sepharose with 50 mM Tris-HCl (pH 8.0), 150 mM NaCl

    • Consider on-column cleavage with PreScission protease

This approach mirrors successful purification strategies used for the PBD domain of other proteins, where GST-fusion proteins are effectively purified and prepared for further analysis .

What assays can be used to assess the membrane transport activity of Pqlc1?

To characterize the membrane transport function of Pqlc1:

  • Liposome Reconstitution Assay:

    • Reconstitute purified Pqlc1 into liposomes

    • Measure substrate transport using radiolabeled compounds or fluorescent indicators

  • Cell-Based Transport Assays:

    • Develop stable cell lines overexpressing Pqlc1

    • Measure transport of potential substrates using fluorescent reporters

  • Electrophysiological Methods:

    • Patch-clamp techniques for real-time monitoring of transport activity

    • Suitable for ion transport characterization

These methodologies provide complementary approaches to assess transport kinetics, substrate specificity, and regulatory mechanisms.

How does Pqlc1 interact with other proteins in cellular pathways?

For investigating Pqlc1 protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Pqlc1 antibodies to pull down protein complexes

    • Identify interaction partners by mass spectrometry

  • Yeast Two-Hybrid Screening:

    • Construct Pqlc1 bait plasmids

    • Screen against mouse cDNA libraries

  • Proximity Labeling Methods (BioID or APEX):

    • Tag Pqlc1 with promiscuous biotin ligase

    • Identify proximal proteins through streptavidin pulldown

Similar to the interaction studies conducted with PQBP1, which revealed interactions with transcription factors and spliceosomal proteins, these approaches can uncover the interaction network of Pqlc1 .

What domain structures of Pqlc1 are critical for its function?

Based on structural analysis of related PQ-loop proteins:

  • PQ-Loop Motifs:

    • Typically contain conserved proline and glutamine residues

    • Form characteristic membrane-spanning domains

    • Essential for transport function

  • N-terminal and C-terminal Domains:

    • May contain regulatory regions

    • Often sites for post-translational modifications

Similar to how the CTD domain of PQBP1 contains critical motifs like YxxPxxVL that are essential for complex formation with other proteins, specific motifs within Pqlc1 domains likely mediate its functional interactions .

What crystallization methods are most successful for structural determination of Pqlc1?

For crystallizing mouse Pqlc1:

  • Membrane Protein Crystallization Strategies:

    • Detergent screening (DDM, LMNG, OG) for protein extraction

    • Lipidic cubic phase (LCP) crystallization

    • Use of crystallization chaperones (antibody fragments, nanobodies)

  • Construct Optimization:

    • Generate truncation constructs removing flexible regions

    • Surface entropy reduction mutations

    • Use thermostabilizing mutations

  • Data Collection Considerations:

    • Microfocus beamlines for small crystals

    • Serial crystallography approaches

The crystal structures of protein complexes like the PBD in complex with Cdc25C and Cdc25C-P target peptides provide methodological precedents for successful structural studies .

How can CRISPR-Cas9 be optimized for generating Pqlc1 knockout or knock-in mouse models?

For CRISPR-Cas9 editing of mouse Pqlc1:

  • gRNA Design Strategy:

    • Target early exons for knockout models

    • Use at least 3 different gRNAs to increase success rate

    • Verify specificity with off-target prediction tools

  • Delivery Methods:

    • Electroporation of ribonucleoprotein complexes for embryos

    • Lentiviral delivery for cell line modifications

  • Verification Protocol:

    • PCR-based genotyping

    • Sanger sequencing of modified regions

    • Western blot confirmation of protein loss

These approaches mirror successful mouse model generation strategies used for studying other proteins, which have provided valuable insights into protein function in vivo .

What are the implications of Pqlc1 dysfunction in mouse disease models?

Based on knowledge of related proteins:

  • Neurological Phenotypes:

    • Similar to PQBP1, which when mutated leads to Renpenning syndrome symptoms, Pqlc1 dysfunction might affect neuronal development and function

    • Assessment requires behavioral testing, electrophysiology, and histological analysis

  • Metabolic Consequences:

    • Potential disruption of lysosomal function

    • Metabolomics analysis for identifying accumulated substrates

  • Immune System Effects:

    • Possible role in pathogen recognition pathways, as observed with PQBP1

    • Analysis through immune cell profiling and challenge models

How can protein-protein interaction studies overcome challenges with membrane-associated Pqlc1?

To address challenges in studying Pqlc1 interactions:

  • Membrane-Compatible Co-IP Methods:

    • Use crosslinking agents (DSP, formaldehyde)

    • Optimize detergent conditions (mild detergents like digitonin)

    • Employ MYTH (Membrane Yeast Two-Hybrid) system

  • Split-Reporter Systems:

    • Split-GFP or NanoBiT for monitoring interactions in live cells

    • Adaptable to membrane protein topology

  • Computational Predictions:

    • Use algorithms trained on membrane protein interactions

    • Validate top predictions experimentally

These approaches can help overcome the typical challenges associated with studying membrane protein interactions.

What are the critical considerations for interpreting Pqlc1 localization studies in cellular contexts?

For accurate interpretation of Pqlc1 localization:

  • Fixation and Permeabilization Optimization:

    • Test multiple fixatives (PFA, methanol, glutaraldehyde)

    • Compare detergents (Triton X-100, saponin, digitonin)

  • Antibody Validation Controls:

    • Use Pqlc1 knockout cells as negative controls

    • Perform peptide competition assays

    • Compare multiple antibodies targeting different epitopes

  • Colocalization Analysis Standards:

    • Use appropriate statistical measures (Pearson's, Manders' coefficients)

    • Employ subcellular markers for precise compartment identification

Similar to studies of Plk1 localization, which revealed important roles for both the kinase domain and PBD in targeting, comprehensive analysis of Pqlc1 localization requires careful experimental design and controls .

How does phase separation influence Pqlc1 function in cellular compartmentalization?

Recent research on protein phase separation provides a framework for investigating Pqlc1:

  • Assessment Methods for Phase Separation:

    • In vitro reconstitution with purified proteins

    • Fluorescence recovery after photobleaching (FRAP)

    • Fluorescence correlation spectroscopy (FCS)

  • Domain Analysis for LLPS Propensity:

    • Identify low complexity domains

    • Assess intrinsically disordered regions

Similar to findings with PQBP1, which is involved in liquid-liquid phase separation partly mediated by its PRD domain, Pqlc1 may participate in phase separation processes that contribute to its cellular functions .

What technological innovations are advancing our understanding of Pqlc1 trafficking dynamics?

Emerging technologies for studying Pqlc1 trafficking include:

  • Live-Cell Super-Resolution Microscopy:

    • PALM/STORM techniques for nanoscale localization

    • Lattice light-sheet microscopy for 3D visualization

  • Optogenetic Control Systems:

    • Light-inducible protein interactions

    • Spatiotemporal control of Pqlc1 function

  • Quantitative Mass Spectrometry Approaches:

    • SILAC labeling for trafficking kinetics

    • Proximity labeling for compartment-specific interactome

These methods provide unprecedented resolution for understanding the dynamic behavior of Pqlc1 in cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.