Recombinant Mouse PRA1 family protein 3 (Arl6ip5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Arl6ip5; Aip5; Jwa; Pra2; Praf3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Addicsin; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; Prenylated Rab acceptor protein 2; Protein JWa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Arl6ip5
Target Protein Sequence
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM VFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFA DYISKARE
Uniprot No.

Target Background

Function
Regulates intracellular concentrations of taurine and glutamate. It negatively modulates SLC1A1/EAAC1 glutamate transport activity by reducing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in retaining SLC1A1/EAAC1 within the endoplasmic reticulum.
Gene References Into Functions
  1. Glutamate transporter-associated protein 3-18 (GTRAP3-18), an anchor protein that retains interacting proteins in the endoplasmic reticulum, plays a crucial role in regulating food intake and body weight by interacting with POMC. GTRAP3-18-deficient mice exhibit hypophagia, lean body mass, and lower blood glucose, insulin, and leptin levels, along with increased serum and brain alpha-MSH levels, ultimately leading to AMPK inhibition. PMID: 28904020
  2. The protective effect of JWA against paraquat neurotoxicity involves the regulation of the MEK/PI3K-Nrf2 axis. PMID: 28428137
  3. JWA deficiency through the cascading FAK-PI3K-Akt-mTOR pathway leads to an increase in newborn neurons. PMID: 25432888
  4. Arl6ip5 is a novel regulator of bone formation in osteoblasts. PMID: 25321471
  5. This study provides evidence that astrocytic JWA expression safeguards DA neurons from degeneration and plays a significant role in neuroprotection through the inhibition of ROS and NF-kappaB activation. PMID: 24628733
  6. Double-fluorescent immunohistochemical analysis reveals that addicsin and TR1 are co-expressed in neurons PMID: 24680664
  7. Data highlight the importance of JWA (Arl6ip5) in maintaining skin homeostasis and in the process of skin tumor development. PMID: 22461904
  8. This study demonstrates that GTRAP3-18(-/-) mice exhibit improved performance in motor/spatial learning and memory tests. Suppression of GTRAP3-18 enhances neuronal resistance to oxidative stress by increasing GSH content, ultimately facilitating cognitive function. PMID: 22210510
  9. Arl6ip1 is a novel addicsin-associated partner that promotes EAAC1-mediated glutamate transport activity by reducing the number of addicsin molecules available for interaction with EAAC1. PMID: 18684713
  10. Exhibits 98% identity with rat GTRAP3-18; upregulated in the amygdala by repeated administration of morphine. PMID: 12438930
  11. Addicsin mRNA is expressed in CNS neurons and may participate in the functional expression of the somatic sensory system by modulating EAAC1-mediated glutamate transport. PMID: 16005150
  12. Our studies demonstrate that H(2)O(2) is the primary oxidative product responsible for benzo[a]pyrene (B[a]P)-induced JWA expression, and knockdown of JWA elevates H(2)O(2) (100 microM)- and B[a]P (100 microM)-induced DNA damage. PMID: 17462538
  13. Inhibits EAAT3-mediated glutamate uptake; highly conserved protein and genomic organization among vertebrates. PMID: 12119102

Show More

Hide All

Database Links
Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.
Tissue Specificity
Expressed in the cerebral cortex, cerebellum, hippocampus, olfactory bulbs, medulla oblongate and limbic system (at protein level). Ubiquitous.

Q&A

What is Arl6ip5 and what are its primary functions in cellular biology?

Arl6ip5 (PRA1 family protein 3) is a multifunctional protein belonging to the PRAF3 family, characterized by a large prenylated acceptor domain 1 primarily involved in intracellular protein trafficking. This protein serves several critical cellular functions including regulation of membrane trafficking, participation in endocytosis pathways, and modulation of apoptotic processes. Notably, Arl6ip5 functions as a negative regulator of the EAAC1 transporter and has been recently identified as an autophagy inducer through interaction with the ATG12 protein . In mouse models, Arl6ip5 (also known as Addicsin in mice) demonstrates significant homology to human JWA and rat GTRAP3-18 proteins, suggesting conserved functions across mammalian species . Research methodologies focusing on these functions typically employ knockout models, overexpression systems, and co-immunoprecipitation assays to characterize protein-protein interactions within trafficking pathways.

How does mouse Arl6ip5 differ from human ARL6IP5 in terms of structure and function?

Mouse Arl6ip5 (Addicsin) and human ARL6IP5 (JWA) maintain highly conserved functional domains but exhibit species-specific differences in amino acid sequence and potentially in regulation patterns. Both proteins share core functional capacities in autophagy induction, protein trafficking, and interaction with glutamate transporters. Experimental approaches to study these differences typically include comparative sequence analysis, cross-species functional rescue experiments, and domain-swap methodologies. While the human version has been extensively studied in cancer metastasis research , mouse models remain invaluable for investigating neurodegenerative disease mechanisms due to their genetic tractability. When designing experiments using recombinant mouse Arl6ip5, researchers should consider these structural similarities and differences, particularly when extrapolating findings to human disease models or when conducting comparative studies across species.

What are the optimal storage and handling conditions for recombinant mouse Arl6ip5 protein?

Recombinant mouse Arl6ip5 protein maintains optimal stability when stored at -20°C for routine use, while long-term storage at -80°C is recommended for preserving functional integrity beyond six months . The protein is typically provided in a liquid form containing glycerol as a cryoprotectant, which helps maintain protein solubility and prevents degradation during freeze-thaw cycles. To minimize protein degradation, aliquoting into single-use volumes before freezing is strongly recommended, as repeated freeze-thaw cycles significantly reduce biological activity. When preparing working aliquots, store at 4°C for up to one week to maintain protein stability .

For experimental protocols requiring protein reconstitution, use sterile, buffered solutions (typically PBS with pH 7.2-7.4) and avoid introducing microbial contamination. Quality control testing should include verification of protein purity by SDS-PAGE and functional testing relevant to your experimental design. Researchers should perform preliminary dose-response assays to establish optimal protein concentrations for their specific experimental systems, as effective concentrations may vary based on cell type and assay conditions.

How can I design effective Arl6ip5 overexpression experiments in neuronal models?

Designing effective Arl6ip5 overexpression experiments in neuronal models requires careful consideration of expression vectors, transfection protocols, and validation methods. For optimal results in neuronal cells (such as SH-SY5Y), use mammalian expression vectors with neuron-specific promoters to ensure appropriate expression levels. Research indicates that 5μg of flag-Arl6ip5 construct transfected over 36 hours yields significant overexpression and functional effects on autophagy pathways in neuronal models .

The transfection protocol should be optimized specifically for neuronal cells, which typically have lower transfection efficiencies compared to other cell types. Options include lipid-based transfection for cell lines, electroporation for primary neurons, or viral vectors (lentivirus or AAV) for in vivo studies. Post-transfection, confirm overexpression through multiple validation approaches:

  • Western blot analysis to quantify protein levels (expect 150-260% increase in expression)

  • Immunofluorescence to assess cellular localization and expression distribution

  • Functional assays to confirm biological activity (such as LC3BII changes for autophagy)

When studying neurodegenerative disease models, co-transfection with disease-relevant proteins (e.g., α-synuclein) at a 1:1 ratio allows assessment of Arl6ip5's protective effects . Include appropriate controls: empty vector controls to account for transfection effects and dose-response studies to determine optimal expression levels that avoid potential artifacts from extreme overexpression.

What techniques are most reliable for measuring Arl6ip5-induced autophagy in experimental models?

Measuring Arl6ip5-induced autophagy requires complementary approaches to capture both static and dynamic aspects of the process. Based on research protocols, three primary methodologies provide reliable quantification of Arl6ip5's impact on autophagy:

  • LC3B Conversion Assay (Western Blot): Quantify the conversion of LC3B-I to LC3B-II, which correlates with autophagosome formation. Studies show Arl6ip5 overexpression increases LC3B-II levels by approximately 195-261% compared to controls . Include appropriate controls such as rapamycin (1μM, 2h treatment) or serum starvation (2h) as positive controls for autophagy induction.

  • Autophagy Flux Assessment: Combine LC3B analysis with lysosomal inhibitors (bafilomycin A1 or chloroquine) to distinguish between increased autophagosome formation and impaired degradation. This approach reveals whether Arl6ip5 affects initiation or completion of autophagy.

  • Fluorescence Microscopy for Autophagosome Quantification: Use GFP-LC3 or immunofluorescence staining to visualize and count LC3 puncta. Arl6ip5 overexpression typically induces 29-33 puncta per cell compared to 8 in control conditions .

For more advanced analysis, monitor substrate clearance (such as α-synuclein degradation) and assess key regulatory pathways using phosphorylation-specific antibodies for ULK1, AMPK, and mTOR. Complementary siRNA knockdown experiments (reducing Arl6ip5 to approximately 16% of normal levels) provide confirmatory evidence by demonstrating reduced LC3B-II levels (58% of control) . These methodological approaches should be integrated to provide robust evidence of Arl6ip5's role in autophagy regulation.

How does Arl6ip5 expression change in neurodegenerative disease models?

Arl6ip5 expression undergoes significant alterations in neurodegenerative disease models, particularly those related to Parkinson's disease (PD). Research in transgenic mouse models of PD demonstrates a substantial decrease in Arl6ip5 levels (to approximately 71% of wild-type levels, p=0.0002) . This finding has been corroborated in human brain sections from PD patients, which show an 85% reduction in Arl6ip5 expression (p=0.0042) .

The expression changes appear to be progressive and correlate with disease severity and aging. In cellular models, overexpression of wild-type α-synuclein reduces Arl6ip5 levels to approximately 70% of control levels (p<0.0001), while the pathogenic A53T mutant α-synuclein causes an even more pronounced reduction to about 60% of normal levels (p<0.0001) . This pattern suggests a relationship between protein aggregation pathology and Arl6ip5 depletion.

Methodologically, these changes are best detected through:

  • Western blot analysis with densitometric quantification

  • Immunohistochemistry on brain sections with region-specific analysis

  • qRT-PCR to assess transcriptional regulation

Researchers investigating Arl6ip5 in neurodegenerative contexts should include age-matched controls and consider both acute and chronic models, as expression patterns may differ between rapid-onset and progressive disease states.

What molecular mechanisms explain Arl6ip5's neuroprotective effects in Parkinson's disease models?

Arl6ip5 exerts neuroprotective effects in Parkinson's disease models through multiple interconnected molecular mechanisms. Central to its neuroprotective function is the enhancement of autophagy, which facilitates the clearance of toxic protein aggregates like α-synuclein. Mechanistic studies reveal that Arl6ip5 operates through the ARL6IP5/Rab1/ATG12 axis , with the following specific pathways:

  • Enhanced Autophagosome Formation: Arl6ip5 overexpression significantly increases LC3B-II levels, promoting the formation of autophagosomes that sequester α-synuclein aggregates. This effect is comparable to standard autophagy inducers like rapamycin and serum starvation .

  • Restoration of Kinase Signaling: Arl6ip5 counteracts α-synuclein-induced dysregulation of critical kinase pathways. It restores phosphorylation of Mer (to 321% of control levels, p<0.0001) and other regulatory kinases that govern cellular survival and autophagy processes .

  • Reduced Cellular Toxicity: In α-synuclein overexpression models, Arl6ip5 significantly reduces cellular toxicity as measured by LDH assays. Conversely, siRNA-mediated Arl6ip5 knockdown exacerbates α-synuclein toxicity by approximately 15% (p=0.018) .

  • Direct Impact on α-Synuclein Aggregation: In cells stably expressing GFP-A53T α-synuclein, Arl6ip5 transfection reduces fluorescent aggregate burden from 58% to 28% (p<0.0001), indicating direct effects on protein aggregation or clearance .

To study these mechanisms, researchers should employ multiple complementary approaches: autophagy flux assays, proximity ligation assays to confirm protein interactions, phospho-specific antibodies to track signaling changes, and live-cell imaging to visualize aggregate clearance dynamics in real time.

How does Arl6ip5 interact with the glutamate transport system, and what are the implications for excitotoxicity research?

Arl6ip5 functions as a negative regulator of the EAAC1 glutamate transporter (also known as EAAT3 or SLC1A1), representing a critical interface between cellular trafficking systems and glutamatergic neurotransmission . This regulatory relationship has significant implications for excitotoxicity research, particularly in the context of neurodegenerative diseases where glutamate homeostasis is disrupted.

For researchers investigating excitotoxicity, several methodological approaches are valuable:

  • Glutamate Uptake Assays: Measuring [³H]-glutamate uptake in cells with modulated Arl6ip5 expression provides functional assessment of transporter activity.

  • Surface Biotinylation Studies: Quantifying plasma membrane-associated EAAC1 in response to Arl6ip5 manipulation reveals changes in transporter trafficking.

  • Electrophysiological Recordings: Whole-cell patch-clamp techniques in neurons with altered Arl6ip5 expression can assess functional consequences on glutamate-induced currents.

  • In Vivo Microdialysis: Measuring extracellular glutamate levels in brain regions of Arl6ip5 knockout or overexpressing mice provides physiologically relevant data.

Research questions should address how Arl6ip5-mediated regulation of glutamate transport interacts with its autophagy-inducing functions, potentially revealing integrated neuroprotective mechanisms. Additionally, investigating how this system responds to oxidative stress and excitotoxic insults may uncover new therapeutic targets for conditions where glutamate dysregulation contributes to pathology.

How can Arl6ip5 knockout cell lines be effectively utilized for pathway analysis in neuronal research?

Arl6ip5 knockout cell lines represent powerful tools for dissecting the protein's role in multiple cellular pathways relevant to neuronal function and pathology. While commercially available knockout lines exist primarily in HeLa cells , researchers can generate neuronal knockout models using CRISPR-Cas9 technology in cell lines like SH-SY5Y or primary neurons. For effective utilization in pathway analysis, consider the following methodological approaches:

  • Comparative Transcriptomics and Proteomics: RNA sequencing and mass spectrometry-based proteomics comparing wild-type and Arl6ip5 knockout neurons reveal global changes in gene expression and protein abundance. This unbiased approach can identify previously unknown pathways regulated by Arl6ip5. Focus analysis on autophagy-related genes, glutamate signaling components, and trafficking machinery.

  • Pathway-Specific Functional Assays: Quantify changes in specific cellular processes:

    • Autophagy flux using tandem fluorescent LC3 (tfLC3) reporters

    • Glutamate uptake rates in knockout versus wild-type cells

    • Vesicle trafficking dynamics using fluorescently-tagged markers

    • Apoptotic responses to various stressors (oxidative, excitotoxic, proteasomal inhibition)

  • Rescue Experiments: Reintroduce wild-type or mutant Arl6ip5 constructs into knockout lines to establish structure-function relationships. Domain-specific mutants can determine which regions of Arl6ip5 are critical for particular functions, such as ATG12 interaction versus EAAC1 regulation.

  • Stress Response Profiling: Challenge knockout cells with stressors relevant to neurodegeneration (α-synuclein overexpression, oxidative stress, proteasome inhibition) and quantify differences in survival, morphology, and molecular responses compared to wild-type cells. Research indicates Arl6ip5 knockdown exacerbates α-synuclein toxicity by approximately 15% , suggesting broader neuroprotective functions.

  • Interactome Analysis: Perform immunoprecipitation followed by mass spectrometry to identify the complete set of Arl6ip5 protein interactions in neuronal contexts, comparing wild-type interactors to those absent in knockout cells.

Data from these approaches should be integrated through computational pathway analysis to develop comprehensive models of Arl6ip5's role in neuronal homeostasis and response to pathological conditions.

What are the methodological considerations for studying Arl6ip5's role in cancer versus neurodegenerative disease models?

Studying Arl6ip5's diverse roles in cancer and neurodegenerative disease models requires distinct methodological approaches tailored to each disease context, while maintaining some overlapping techniques. These considerations ensure reliable, context-appropriate data collection:

Cell Model Selection and Preparation:

  • Cancer Research: Utilize established cancer cell lines (HeLa, MCF-7) and patient-derived xenografts to study metastasis and proliferation . For translational relevance, compare Arl6ip5 expression between tumor and adjacent normal tissues.

  • Neurodegenerative Research: Employ neuronal cell lines (SH-SY5Y), primary neurons, or induced pluripotent stem cell (iPSC)-derived neurons from patients. Age the cultures when modeling age-dependent diseases, as Arl6ip5 levels decrease with age in brain tissue .

Functional Endpoints and Assays:

  • Cancer Focus: Measure proliferation rates, migration (wound healing assays), invasion (transwell assays), and resistance to apoptosis. Assess effects on oncogenic signaling pathways.

  • Neurodegeneration Focus: Quantify protein aggregation clearance, neuronal survival, neurite integrity, and mitochondrial function. Include specialized assays for synaptic function when using primary neurons.

Animal Models:

  • Cancer Models: Employ subcutaneous or orthotopic xenograft models with Arl6ip5 manipulation to assess tumor growth and metastasis.

  • Neurodegeneration Models: Use transgenic mice expressing α-synuclein (for PD studies) or other disease-relevant proteins with concurrent Arl6ip5 manipulation. Behavioral testing should complement molecular analyses.

Pathway Analysis and Data Integration:

ParameterCancer FocusNeurodegeneration FocusOverlapping Methods
Key PathwaysEMT, MAPK, PI3K/AktAutophagy, UPR, mitochondrial functionApoptosis, oxidative stress
Primary ReadoutsProliferation, metastasisAggregate clearance, neuron survivalCell viability, protein expression
TimeframeRapid division cycles (hours to days)Extended cultures (days to weeks)Depends on specific endpoints
Drug ResponseChemotherapeutic agentsNeuroprotective compoundsAutophagy modulators

When designing experiments, account for the differential expression of Arl6ip5 across tissues and disease states. In neurodegenerative contexts, expression decreases to approximately 71-85% of normal levels , while expression patterns may vary in different cancer types. These differences necessitate careful validation of baseline expression before manipulation studies.

How can computational modeling enhance our understanding of Arl6ip5's role in protein-protein interactions and pathway regulation?

Computational modeling provides powerful approaches for understanding Arl6ip5's complex role in protein-protein interactions and pathway regulation. These in silico methods complement experimental techniques and can accelerate hypothesis generation and mechanistic insights:

  • Structural Modeling and Interaction Prediction: Since the complete crystal structure of Arl6ip5 remains unresolved, homology modeling based on related PRAF family proteins can predict structural domains critical for interaction with partners like ATG12 and Rab1. Molecular docking simulations can then identify potential binding interfaces and predict how mutations might affect these interactions. These models should be validated through targeted mutagenesis experiments testing the predicted critical residues.

  • Network Analysis of Arl6ip5 Interactome: Integrating existing protein-protein interaction data with expression profiles from different tissues can generate tissue-specific interaction networks centered on Arl6ip5. This approach reveals how Arl6ip5 may function as a hub connecting autophagy machinery (through ATG12 interaction) with membrane trafficking systems. Differential network analysis between healthy and disease states can identify disrupted connections potentially amenable to therapeutic intervention.

  • Pathway Simulation Using Ordinary Differential Equations (ODEs): Mathematical modeling of Arl6ip5-regulated pathways using ODEs allows prediction of system dynamics under varying conditions. For example, models incorporating Arl6ip5's role in autophagy can simulate how changes in its expression would affect autophagosome formation rates and α-synuclein clearance kinetics. These simulations can be calibrated using experimental data showing that Arl6ip5 overexpression increases LC3B-II levels by 195-261% .

  • Multi-scale Modeling Approaches:

    • Molecular Scale: Molecular dynamics simulations of Arl6ip5's interaction with membrane systems

    • Cellular Scale: Agent-based models of protein trafficking and autophagy regulation

    • Tissue Scale: Predictions of how altered Arl6ip5 expression affects tissue-level responses in brain or tumor microenvironments

  • Machine Learning Integration: Supervised learning algorithms trained on experimental datasets can predict how various stressors or therapeutic compounds might affect Arl6ip5 expression and function. This approach is particularly valuable for drug repositioning efforts targeting Arl6ip5-related pathways.

Researchers should iteratively refine computational models based on experimental validation, creating a cycle where in silico predictions guide wet-lab experiments, which in turn improve model accuracy and predictive power.

What are the key quality control parameters for validating recombinant mouse Arl6ip5 preparations?

Rigorous quality control is essential for ensuring recombinant mouse Arl6ip5 preparations meet the standards required for reliable research applications. A comprehensive validation protocol should incorporate the following parameters and analytical techniques:

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining to visualize protein bands (target: >90% purity)

    • Size exclusion chromatography to detect aggregates and confirm monomeric state

    • Mass spectrometry to verify intact molecular weight and detect potential modifications or truncations

  • Identity Confirmation:

    • Western blot analysis using specific anti-Arl6ip5 antibodies

    • Peptide mapping via mass spectrometry to confirm sequence coverage

    • N-terminal sequencing to verify absence of unexpected processing

  • Functional Activity Validation:

    • Binding assays with known interaction partners (ATG12, EAAC1)

    • Autophagy induction assay in appropriate cell lines (expected 150-260% increase in LC3B-II levels)

    • Circular dichroism spectroscopy to confirm proper secondary structure folding

  • Contaminant Testing:

    • Endotoxin testing by LAL assay (target: <1 EU/mg protein)

    • Host cell protein ELISA (target: <100 ppm)

    • DNA contamination assessment (target: <10 ng/mg protein)

  • Stability Indicators:

    • Accelerated stability studies at various temperatures

    • Freeze-thaw stability testing (protein should maintain >90% activity after 3 cycles)

    • Solution stability in various buffers relevant to experimental conditions

For specialized applications, additional validation may be required, such as glycosylation analysis for studies focusing on post-translational modifications. Researchers should maintain detailed records of all quality control parameters for each batch of recombinant protein and include lot-specific activity data in experimental documentation to ensure reproducibility. For critical experiments, side-by-side testing of multiple protein lots can help identify any lot-to-lot variation that might affect experimental outcomes.

How can researchers effectively compare results from different sources of recombinant Arl6ip5 protein?

Comparing results obtained using recombinant Arl6ip5 from different sources requires systematic approaches to account for variations in protein preparation, purity, and functionality. Researchers should implement the following methodological strategies to ensure valid comparisons:

  • Standardized Activity Normalization: Rather than relying solely on protein concentration, establish a functional activity assay specific to Arl6ip5, such as autophagy induction capacity or EAAC1 binding. Express experimental dosing in terms of functional units rather than absolute protein quantity. For instance, determine the amount of each preparation required to induce a 200% increase in LC3B-II levels in a standard cell line .

  • Side-by-Side Comparative Analysis: Design experiments that test multiple protein sources simultaneously under identical conditions. This direct comparison minimizes experimental variability and clearly reveals source-dependent differences. Include the following assessments:

    • Dose-response curves for key functional readouts

    • SDS-PAGE and Western blot visualization of protein integrity

    • Thermal stability profiles using differential scanning fluorimetry

  • Comprehensive Documentation and Reporting: When publishing or comparing results, document and report:

    ParameterRequired InformationImpact on Interpretation
    Expression SystemHost organism (E. coli, mammalian, etc.)Affects post-translational modifications
    Purification MethodTag system, chromatography stepsInfluences purity and protein conformation
    Buffer CompositionSalt concentration, pH, additivesAffects stability and activity
    Storage ConditionsTemperature, concentration, additivesImpacts long-term stability
    Lot NumberSpecific production batchEnables traceability for reproducibility
  • Reference Standard Implementation: Establish or obtain a reference standard preparation of Arl6ip5 against which all other sources can be calibrated. This approach is particularly important for longitudinal studies where different protein batches may be used over time.

  • Analytical Quality Comparison: Perform comparative analytical characterization of different sources using:

    • Mass spectrometry to identify any sequence variations or modifications

    • Circular dichroism to compare secondary structure profiles

    • Dynamic light scattering to assess aggregation propensity

When differences between sources are identified, correlate these with functional outcomes to determine which properties are critical for specific applications. This systematic approach enables researchers to make informed decisions about which recombinant protein source is most appropriate for their particular experimental needs.

What are the advanced applications of recombinant Arl6ip5 in high-throughput screening for neurodegenerative disease therapeutics?

Recombinant Arl6ip5 offers versatile applications in high-throughput screening (HTS) platforms focused on discovering neurodegenerative disease therapeutics. These advanced screening approaches leverage Arl6ip5's involvement in autophagy regulation and neuroprotection against protein aggregation pathologies:

  • Target-Based Screening Approaches:

    • Arl6ip5-Protein Interaction Modulators: Develop fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays using labeled recombinant Arl6ip5 and its binding partners (ATG12, Rab1) to screen for compounds that enhance beneficial interactions. This approach can identify molecules that strengthen Arl6ip5's autophagy-inducing capabilities.

    • Arl6ip5 Expression Enhancers: Screen for compounds that increase Arl6ip5 expression using reporter gene assays with the Arl6ip5 promoter region driving luciferase expression. This strategy targets the observed reduction of Arl6ip5 levels in neurodegenerative states .

  • Phenotypic Screening Platforms:

    • Autophagy Modulation Assays: Utilize cells expressing fluorescent autophagy reporters (GFP-LC3 or tfLC3) to identify compounds that replicate or enhance Arl6ip5's effect on autophagy. Compare hits to the effects of recombinant Arl6ip5 overexpression as a biological reference standard.

    • Protein Aggregation Clearance: Screen for compounds that, like Arl6ip5, reduce α-synuclein aggregate burden in neuronal models. High-content imaging systems can quantify changes in aggregate number, size, and distribution.

  • Combination Screening Strategies:

    • Arl6ip5 Synergy Screening: Identify compounds that synergize with sub-maximal doses of recombinant Arl6ip5 to enhance neuroprotection, potentially revealing adjunctive therapeutic approaches.

    • Pathway Convergence Screening: Test compounds that target complementary pathways to Arl6ip5 (e.g., mTOR inhibitors, ULK1 activators) to identify optimal combination approaches for maximum therapeutic effect.

  • Advanced Screening Technologies:

    • Microfluidic-Based Single Cell Analysis: Assess compound effects on Arl6ip5 function at the single-cell level, enabling detection of population heterogeneity in response.

    • CRISPR-Based Functional Genomics: Combine genome-wide CRISPR screens with Arl6ip5 overexpression to identify genetic modifiers that enhance or suppress its neuroprotective functions.

  • Translational Validation Approaches:

    • Ex Vivo Brain Slice Models: Validate HTS hits using organotypic brain slices from transgenic mouse models, assessing effects on Arl6ip5 expression and function in intact neural circuits.

    • iPSC-Derived Patient Neurons: Confirm efficacy in neurons derived from patients with neurodegenerative diseases, providing personalized medicine applications.

Implementation of these approaches requires careful assay development and validation, with particular attention to Z-factor optimization, signal-to-background ratios, and minimizing false positives. The recombinant Arl6ip5 used should undergo rigorous quality control as outlined in FAQ 5.1 to ensure reproducible screening results across batches and experimental replicates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.