Recombinant Mouse Presqualene diphosphate phosphatase (Ppapdc2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type preferences, please inform us, and we will prioritize fulfilling your requirements.
Synonyms
Plpp6; Ppapdc2; Phospholipid phosphatase 6; Phosphatidic acid phosphatase type 2 domain-containing protein 2; Presqualene diphosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plpp6
Target Protein Sequence
MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGSGGGRFEFQSLLNCRAGADPACARLRASDS PVHRRGSFPLAASGPAQAAPAPPPEDARMNLNPSFLGIALRSLLAIDLWLSKKLGVCAGE SSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAVI KGLVRRRRPAHNQKDMFFTLSVDRYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLWA FVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNVPVLFVLWNQQ
Uniprot No.

Target Background

Function
Presqualene diphosphate phosphatase (Ppapdc2) is a phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting a potential indirect involvement in innate immunity. PSDP is a bioactive lipid that undergoes rapid remodeling to PSMP upon cell activation. Ppapdc2 exhibits diphosphate phosphatase activity with a substrate preference for PSDP > FDP > phosphatidic acid.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Presqualene diphosphate phosphatase (Ppapdc2) and what are its primary functions?

Ppapdc2 (also known as PDP1) is an integral membrane lipid phosphatase enzyme that catalyzes the conversion of presqualene diphosphate (PSDP) to presqualene monophosphate (PSMP). The enzyme belongs to the lipid phosphate phosphohydrolase family but displays unique substrate preferences that distinguish it from other members. Ppapdc2 contains a lipid phosphatase catalytic domain with three conserved motifs (C1, C2, and C3) essential for its phosphatase activity .

At the molecular level, Ppapdc2 functions primarily in the metabolism of polyisoprenoid diphosphates, which are crucial intermediates in the mevalonate pathway responsible for cholesterol synthesis and protein isoprenylation. The enzyme preferentially hydrolyzes polyisoprenoid diphosphates, including farnesyl diphosphate (FPP) and geranylgeranyl diphosphate (GGPP), over other glycerol- and sphingo-phospholipid substrates . This selective dephosphorylation activity positions Ppapdc2 as a potential regulator of isoprenoid phosphate metabolism, influencing both sterol synthesis and protein modification processes.

How does the substrate specificity of Ppapdc2 compare to other lipid phosphatases?

Ppapdc2 demonstrates a distinctive substrate preference hierarchy that sets it apart from related phosphatases. Kinetic analyses of recombinant Ppapdc2 have revealed the following substrate preference order: PSDP > FPP > phosphatidic acid . This contrasts with conventional lipid phosphate phosphatases (LPPs), which typically prefer glycerophospholipids and sphingolipids as substrates.

The unique substrate preference of Ppapdc2 appears to be based on differences in Vmax values rather than Km values. In comparative enzymatic studies using mixed micelle assays, the Vmax values for isoprenoid diphosphate substrates were approximately 4-fold higher than for glycero- or sphingo-phospholipid substrates, while the apparent Km values remained comparable across substrate types. This kinetic profile explains the preference observed at low substrate concentrations commonly used in standard assays .

Substrate TypeRelative ActivityKey Features
PSDP100%Complete dephosphorylation proceeds sequentially
FPP~80%Important intermediate in sterol synthesis
GGPP~75%Critical for protein geranylgeranylation
Phosphatidic acid~25%Common substrate for LPPs
Other phospholipids<20%Including S1P, C1P, and DGPP

Note: Values approximated from experimental data in the literature

What is the cellular localization of Ppapdc2 and how does it relate to function?

Ppapdc2 exhibits a distinct subcellular localization pattern that aligns with its role in isoprenoid metabolism. In mammalian cells, the enzyme localizes predominantly to the endoplasmic reticulum (ER) and nuclear envelope . This localization pattern is significant because the ER is a primary site for isoprenoid and sterol biosynthesis.

Unlike the structurally related lipid phosphate phosphatases (LPPs), Ppapdc2 features a four-transmembrane helical topology that orients its catalytic domain sequences (C1 and C2) facing the cytoplasmic side of the membrane . This orientation allows the enzyme to access cytosolic pools of isoprenoid diphosphates that serve as substrates for sterol synthesis and protein prenylation reactions.

Experimental evidence supporting this topology comes from proteolysis studies showing that a C-terminal GFP tag appended to Ppapdc2 was susceptible to degradation in cells treated with trypsin in the presence of membrane-permeabilizing agents. This confirmed that the C-terminus of the protein faces the cytoplasm, consistent with the predicted membrane orientation of the enzyme .

What are the optimal conditions for assaying recombinant Ppapdc2 activity in vitro?

Successful biochemical characterization of Ppapdc2 requires careful consideration of assay conditions that maintain enzyme stability and activity. Based on published protocols, the following conditions yield optimal enzyme activity:

Buffer Composition:

  • 100 mM Tris-maleate buffer at pH 7.0-8.0 (optimal pH range for activity)

  • 0.5% Triton X-100 (critical for solubilization of both enzyme and lipid substrates)

  • 10 mM dithiothreitol (for maintaining reduced state of catalytic cysteine residues)

Key Assay Parameters:

  • Temperature: 37°C

  • Reaction time: Linear activity observed for up to 90 minutes

  • Protein concentration: Activity proportional to enzyme concentration at 1-10 μg/ml range

  • No requirement for Mg²⁺ (distinct from many phosphatases that require divalent cations)

For quantitative measurement of phosphate release, the malachite green colorimetric assay provides reliable detection with high sensitivity. When working with isoprenoid diphosphate substrates, it's advisable to prepare them in mixed micelles with Triton X-100 at molar ratios that maintain substrate presentation in a physiologically relevant manner .

For recombinant protein expression, mammalian expression systems utilizing HEK293 cells yield functionally active enzyme when purified with mild detergents. Epitope tags (such as V5) positioned at the C-terminus allow for immunoaffinity purification without compromising catalytic activity .

How can isoprenoid diphosphate levels be measured in cellular systems expressing Ppapdc2?

Measuring isoprenoid diphosphate levels in biological samples presents technical challenges due to their low abundance and chemical properties. Several complementary approaches can be employed:

LC-MS/MS Analysis:
The most direct approach involves liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS). This method requires careful sample preparation to extract and stabilize these labile compounds:

  • Rapid quenching of cellular metabolism using cold 2-propanol/ammonium bicarbonate (pH 8.0)

  • Selective enrichment of phosphorylated isoprenoids using solid-phase extraction

  • Separation by reverse-phase HPLC using C18 columns

  • Detection by negative-mode electrospray ionization and selective reaction monitoring

Chemical Reporter Strategy:
An alternative approach utilizes synthetic isoprenoid analogs with chemical properties that facilitate detection. The anilinogeraniol (AGOH) reporter system is particularly valuable:

  • Cells are incubated with exogenous AGOH, which is metabolized to AGPP

  • The anilinogeranyl moiety can be detected by both mass spectrometry and immunological methods

  • Conversion dynamics reveal the activity of phosphorylation and dephosphorylation pathways

  • Changes in AGPP levels upon Ppapdc2 expression provide functional evidence of enzyme activity in intact cells

Sterol Pathway Metabolite Analysis:
Indirect assessment of Ppapdc2 activity can be achieved by measuring downstream metabolites in the sterol pathway:

  • Cholesterol and intermediates are quantified by GC-MS or LC-MS

  • Ergosterol levels in yeast models expressing Ppapdc2

  • Protein prenylation status via gel mobility shifts or specific antibodies against prenylated proteins

What expression systems are most effective for producing functional recombinant Ppapdc2?

The choice of expression system significantly impacts the yield and functionality of recombinant Ppapdc2. Based on published methodologies, the following systems have proven effective:

Mammalian Expression Systems:
HEK293 cells provide an optimal environment for expressing functional Ppapdc2. This system offers appropriate post-translational modifications and membrane integration:

  • Transfection with expression vectors containing full-length Ppapdc2 cDNA under CMV promoter

  • Addition of epitope tags (V5 or FLAG) at the C-terminus for purification and detection

  • Expression for 48-72 hours yields sufficient protein for biochemical characterization

  • Extraction with mild detergents (0.5-1% Triton X-100) preserves enzyme activity

Yeast Expression Systems:
While yeast lacks endogenous Ppapdc2, inducible expression systems allow controlled production and functional studies:

  • Galactose-inducible promoters (pYES vectors) enable regulated expression

  • The impact on ergosterol synthesis provides a functional readout

  • Phenotypic effects (growth defects, sterol auxotrophy) correlate with enzymatic activity

  • Cellular pools of FPP can be directly measured by mass spectrometry

  • Expression of catalytic domain fragments rather than full-length protein

  • Refolding from inclusion bodies in the presence of detergents

  • Limited success in producing enzymatically active material

How does Ppapdc2 regulate the mevalonate pathway and affect protein isoprenylation?

Ppapdc2 functions as a regulator of isoprenoid phosphate metabolism with significant implications for the mevalonate pathway and protein prenylation. The enzyme's dephosphorylation of key isoprenoid diphosphates creates a regulatory node that influences multiple cellular processes.

Impact on Mevalonate Pathway:
Ppapdc2-mediated dephosphorylation of FPP and GGPP affects substrate availability for downstream enzymes:

  • Depletion of FPP reduces substrate for squalene synthase, the first committed enzyme in sterol synthesis

  • Overexpression of Ppapdc2 in yeast demonstrates this effect through induction of sterol auxotrophy

  • Cellular pools of FPP decrease significantly upon Ppapdc2 induction, confirming direct impact on pathway intermediates

  • This activity may represent a previously unappreciated regulatory step in cholesterol synthesis regulation

Effects on Protein Isoprenylation:
The prenylation of proteins, particularly small GTPases, depends on the availability of isoprenoid diphosphates:

  • Overexpression of Ppapdc2 substantially decreases protein isoprenylation

  • Rho family GTPases show reduced membrane association and activation

  • Cellular consequences include defects in growth and cytoskeletal organization

  • These effects can be rescued by supplementation with exogenous isoprenoids

The physiological significance of this regulation may relate to coordination between sterol synthesis and protein modification. By modulating the availability of shared isoprenoid diphosphate intermediates, Ppapdc2 could influence the balance between these two major cellular processes, potentially in response to metabolic conditions or developmental signals .

How can site-directed mutagenesis be used to study structure-function relationships in Ppapdc2?

Site-directed mutagenesis provides powerful insights into the catalytic mechanism and structural requirements of Ppapdc2. The enzyme contains three conserved phosphatase catalytic motif sequences (C1, C2, C3) that are critical for its function.

Key Residues for Catalysis:
Mutagenesis studies have identified essential amino acids in the catalytic site:

  • The conserved residues in each phosphatase motif are required for activity

  • Mutation of these residues abolishes enzymatic function

  • The S212T mutation in particular has been used as a catalytically inactive control in cellular studies

  • These findings confirm that Ppapdc2 uses a similar catalytic mechanism to related phosphatases

Experimental Approach for Mutagenesis Studies:
When designing mutagenesis experiments for Ppapdc2, consider the following methodological aspects:

  • Site-directed mutations can be generated using the QuikChange protocol or similar PCR-based methods

  • Expression vectors should contain epitope tags for easy detection and purification

  • Parallel expression of wild-type and mutant proteins allows direct comparison of activity

  • Functional consequences can be assessed through:

    • In vitro phosphatase assays with purified proteins

    • Cellular phenotypes in overexpression systems

    • Complementation studies in yeast models

MutationLocationEffect on ActivityPhenotypic Impact
S212TC2 motifComplete loss of activityNo growth defects in yeast
Mutations in C1 motifN-terminal regionAbolished activityNo effect on localization
Mutations in C3 motifC-terminal regionAbolished activityMembrane insertion maintained

Table based on data from experimental studies of PDP1/PPAPDC2

How does Ppapdc2 relate to other members of the phosphatidic acid phosphatase domain-containing family?

Ppapdc2 belongs to a family of proteins containing phosphatidic acid phosphatase domains, which includes two other members: PPAPDC1 and PPAPDC3/NET39. Despite sequence similarities, these proteins show distinct functional characteristics and expression patterns.

Comparative Analysis of PPAPDC Family Members:

  • Ppapdc2 (PDP1):

    • Functions as an active phosphatase with preference for isoprenoid diphosphates

    • Contains fully conserved catalytic motifs essential for activity

    • Localizes to ER and nuclear envelope with cytoplasm-facing catalytic domain

    • Widely expressed in multiple tissues

  • PPAPDC3/NET39:

    • Highly expressed in cardiac and skeletal muscle tissues

    • Significantly upregulated during myoblast differentiation

    • Contains a lipid phosphate phosphatase (LPP) homology domain

    • Localizes to the nuclear envelope

    • Does not exhibit significant phosphatase activity against standard substrates

  • PPAPDC1:

    • The catalytic motif is not conserved

    • Does not exhibit lipid phosphatase activity

    • Biological function remains largely uncharacterized

This comparison reveals that despite structural similarities, the three PPAPDC family members have diverged significantly in terms of catalytic activity and biological function. Ppapdc2 stands out as the only member with confirmed phosphatase activity against isoprenoid diphosphates, suggesting evolutionary specialization within this protein family .

What are the most effective approaches for studying Ppapdc2 function in vivo?

Investigating the physiological role of Ppapdc2 requires complementary in vivo approaches that can reveal its function in complex biological systems. Several experimental strategies have proven valuable:

Genetic Manipulation Models:

  • Conditional knockout mouse models:

    • Tissue-specific deletion using Cre-lox technology

    • Analysis of metabolic consequences in isoprenoid-dependent tissues

    • Examination of neutrophil function and inflammatory responses

  • Heterologous expression in yeast:

    • Yeast lacks endogenous Ppapdc2

    • Galactose-inducible expression reveals effects on sterol metabolism

    • Growth in sterol-supplemented media rescues phenotypes

    • Provides clean system for structure-function studies

Chemical Biology Approaches:

  • Small molecule modulators:

    • Inhibitors targeting the phosphatase catalytic site

    • Screens using isoprenoid diphosphate hydrolysis assays

    • Validation in cellular systems using mass spectrometry

  • Isoprenoid reporter systems:

    • Anilinogeraniol (AGOH) as a chemical reporter

    • Tracks interconversion between isoprenols and isoprenoid diphosphates

    • Reveals pathway dynamics in intact cells

Disease Model Applications:
Recent research suggests potential applications in disease models where isoprenoid metabolism is disrupted:

  • Mouse models of cholesterol metabolism disorders

  • Investigation of mevalonate pathway inhibitors (statins) and their effects

  • Potential role in modulating squalene synthase inhibitor toxicity

  • Connection to PI3K signaling pathways implicated in cancer

Future research directions include development of more selective tools to modulate Ppapdc2 activity in vivo and comprehensive phenotyping of genetic models to fully elucidate the enzyme's physiological functions across different tissues and developmental stages.

How might Ppapdc2 interact with other regulatory pathways beyond isoprenoid metabolism?

Recent research has revealed potential connections between Ppapdc2 and several major signaling networks, suggesting broader regulatory roles beyond its direct enzymatic function in isoprenoid metabolism.

Intersection with PI3K/Hippo/mTOR Signaling:
Emerging evidence suggests potential cross-talk between isoprenoid metabolism and other signaling pathways:

  • PI3K inhibition affects TAZ/YAP and mTORC1 signaling axes

  • Knock-out studies of pathway components reveal differential expression of genes involved in Hippo signaling

  • These connections may provide context for how isoprenoid metabolism interfaces with growth control pathways

  • Ppapdc2, by modulating isoprenoid diphosphate levels, could influence these signaling networks

Potential Role in Protein Phosphatase 2A (PP2A) Regulation:
PP2A is a major serine/threonine phosphatase with tumor suppressor activity:

  • PP2A activity can be modulated by various lipids

  • The dephosphorylation of specific substrates by PP2A affects multiple signaling pathways including Ras-MAPK

  • Ppapdc2-generated lipid products could potentially influence PP2A function

  • This connection remains speculative but represents an intriguing area for future investigation

Antigen Processing and Presentation Pathways:
Transcriptional profiling has identified links between lipid metabolism and immune function:

  • Pathway analysis of foam cells reveals differential expression of genes involved in antigen processing and presentation

  • Similar pathways are affected in models of TAZ/YAP signaling

  • Ppapdc2's role in neutrophil function may extend to broader immunological processes

  • This suggests potential implications for inflammatory and immune-related conditions

These emerging connections highlight the need for systems biology approaches to fully understand how Ppapdc2 functions within the broader context of cellular signaling networks. Integration of proteomics, lipidomics, and transcriptomics data will be essential for mapping these relationships comprehensively.

What are the optimal storage and handling conditions for recombinant Ppapdc2 protein?

Maintaining the stability and activity of recombinant Ppapdc2 requires careful attention to storage and handling conditions. As a membrane-associated enzyme with multiple transmembrane domains, Ppapdc2 presents unique challenges for long-term preservation of activity.

Recommended Storage Conditions:

  • Store purified protein at -20°C or -80°C for extended storage

  • Use a storage buffer containing Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity

  • Prepare working aliquots that can be stored at 4°C for up to one week

Stabilization Strategies:

  • Maintain protein in detergent micelles (0.5% Triton X-100 or similar non-ionic detergent)

  • Include reducing agents (DTT or β-mercaptoethanol) to protect catalytic cysteine residues

  • Optimize pH for stability (pH 7.0-7.5 is typically suitable)

  • Consider addition of glycerol (10-50%) to prevent freeze-damage

Activity Preservation:
For maintenance of enzymatic activity during storage and experimentation:

  • Verify activity periodically using phosphatase assays with isoprenoid diphosphate substrates

  • Monitor protein integrity by SDS-PAGE or Western blotting

  • Reconstitute in appropriate detergent micelles before activity assays

  • For long-term projects, consider fresh preparations rather than relying on stored material

By following these guidelines, researchers can maintain recombinant Ppapdc2 in a functional state suitable for both biochemical characterization and application in complex experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.