Recombinant Mouse Probable C-C chemokine receptor type 3 (Ccr3)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Properties of Recombinant Mouse CCR3

PropertyDetail
Molecular Weight~41.0 kDa
Host SystemE. coli, HEK293, or mammalian cells
TagsHis, Fc, Avi, or GST for purification and detection
LigandsCCL11, CCL26, CCL7, CCL13, CCL5

Research Applications

Recombinant Mouse CCR3 is widely used to study eosinophil biology, allergic inflammation, and neuroimmunology.

Allergic Disease Models

  • Eosinophil Depletion: Anti-CCR3 antibodies (e.g., 6S2-19-4) selectively deplete eosinophils in vivo, reducing airway inflammation in asthma models .

  • Gene Knockdown: Lentiviral shRNA targeting CCR3 inhibits eosinophil proliferation and promotes apoptosis, alleviating symptoms in allergic rhinitis (AR) mice .

    • Key Finding: CCR3 knockdown reduced nasal mucosa eosinophil infiltration by 60% and normalized Th1/Th2 cytokine balance .

Neuroinflammation and Aging

  • Cognitive Dysfunction: CCR3 inhibition (e.g., AKST4290) reverses age-related cognitive decline in mice by blocking T-cell infiltration into the brain .

    • Key Finding: Aged mice treated with AKST4290 showed a 40% improvement in spatial memory tasks .

  • Blood-Brain Barrier (BBB) Regulation: CCR3+ T cells in the choroid plexus increase sixfold with aging, driving neuroinflammation .

Comparative Analysis Across Species

Recombinant CCR3 is available for multiple species, facilitating cross-species translational research.

Table 2: Recombinant CCR3 Variants

SpeciesHost SystemApplicationsSource
Mouse (Mus musculus)E. coliAllergic inflammation, neuroimmunology Creative BioMart
HumanHEK293HIV entry studies, asthma models Abcam
RatMammalian cellsParasitic infection models Bio X Cell

Therapeutic Implications

  • Asthma: CCR3 antagonists reduce eosinophil recruitment by 70% in murine models .

  • Autoimmune Diseases: CCR3 inhibition mitigates T-cell infiltration in multiple sclerosis models .

  • HIV Research: CCR3 serves as a co-receptor for HIV-1 entry, though less prominent than CCR5/CXCR4 .

Key Research Findings

  1. CCR3 in Aging: Systemic CCR3 inhibition restores cognitive function in aged mice by reducing peripheral T-cell infiltration into the brain .

  2. Allergic Rhinitis: CCR3-deficient mice show 50% lower nasal symptom scores compared to wild-type controls .

  3. Structural Insights: Cryo-EM resolved CCR3’s apo state and CCL2-bound conformation, identifying druggable pockets .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development according to your request.
Synonyms
Ccr3; Cmkbr1l2; Cmkbr3; Probable C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Macrophage inflammatory protein 1-alpha receptor-like 2; MIP-1 alpha RL2; CD antigen CD193
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAFNTDEIKTVVESFETTPYEYEWAPPCEKVRIKELGSWLLPPLYSLVFIIGLLGNMMVV LILIKYRKLQIMTNIYLFNLAISDLLFLFTVPFWIHYVLWNEWGFGHYMCKMLSGFYYLA LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFATITSIITWGLAGLAALPEFIFHESQD SFGEFSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK AIRLIFVVMIVFFIFWTPYNLVLLFSAFHSTFLETSCQQSKHLDLAMQVTEVIAYTHCCI NPVIYAFVGERFRKHLRLFFHRNVAVYLGKYIPFLPGEKMERTSSVSPSTGEQEISVVF
Uniprot No.

Target Background

Function
Ccr3 is a receptor for C-C type chemokines. It binds and responds to various chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5), and CCL15. This binding triggers signal transduction by increasing intracellular calcium ion levels. Additionally, Ccr3 may serve as a functional receptor for NARS1.
Gene References Into Functions
  1. Our research revealed irregularities in sleep patterns during the resting phase and in the number of Hcrt neurons in Ccr3 knockout mice. These findings suggest a role for CCR3 in sleep-wake regulation in narcolepsy patients PMID: 29186205
  2. Our study established that CCR3 plays a critical role in neuronal injury. CCR3 deletion or inhibition protects neurons from oxygen-glucose-deprivation-induced cytotoxicity in primary cortical cultures. Ccr3 knockout mice also exhibited a significant reduction in infarct volume in the brain after experimental stroke. PMID: 27822494
  3. Retinal inhibition of CCR3 induces retinal cell death in a murine model of choroidal neovascularization. PMID: 27309355
  4. Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion, which stimulates CCR3-expressing tumor cells. PMID: 26756352
  5. RNA interference therapy targeting CCR3 through local intranasal administration can suppress the development, migration, and invasion of allergic rhinitis eosinophils. PMID: 24507645
  6. Chemokine CCR3 ligand-binding peptides were identified from a random phage-epitope library. PMID: 23183094
  7. CCR3 does not play a role in choroidal neovascularization development. PMID: 22183343
  8. Our findings suggest that CB2R activation results in "cross-talk" with CCR-3, leading to decreased migratory responsiveness to Tat. PMID: 21735070
  9. CCR3 does not play a significant role in choroidal neovascularization development. PMID: 21358803
  10. The CCR3/eotaxin pathway is involved in regulating allergen-driven in situ hematopoiesis and the accumulation/mobilization of eosinophil-lineage-committed progenitor cells in the lung. PMID: 20875077
  11. Trafficking to the cell surface of nascent CCR3 is critically dependent on a C-terminal leucine residue, suggesting specific mechanisms for CCR3 export. PMID: 20541248
  12. CCR3 deficiency does not alter mast cell phenotype or their ability to migrate in vitro. PMID: 20050333
  13. CCR3 is essential for skin eosinophilia and airway hyperresponsiveness in a murine model of allergic skin inflammation. PMID: 11877470
  14. A 3-fold increase in expression in IL-5 transgenic mice leads to enhanced responsiveness of eosinophils to eotaxin. PMID: 12083417
  15. CCR3 plays a role in the endogenous mechanisms involved in inflammatory cell recruitment in an experimental model of allergic cutaneous reaction. PMID: 12118095
  16. CCR3 is constitutively expressed on CD34+ progenitor cells obtained from cord blood and functions as a receptor, transducing in vitro and in vivo chemotactic responses upon binding to its ligand eotaxin. PMID: 12496441
  17. Eosinophils exhibit extended survival under the influence of CCR3-reactive chemokines, contributing to their infiltration into tissues. Moreover, eosinophils may survive even longer if they encounter survival factors at local inflammatory sites. PMID: 12673069
  18. Distinct acidic and basic residues within CCR3 determine both receptor expression and activation by the eotaxins. PMID: 16102831
  19. The CCR3 pathway plays a fundamental role in eosinophil recruitment during ovalbumin-induced experimental asthma. PMID: 16210640
  20. CCL11 and CCR3 are crucial for pulmonary granulocyte recruitment and play significant pathogenic roles in bleomycin-induced lung fibrosis. PMID: 16314464
  21. YM-344031, a novel and selective small molecule CCR3 antagonist, potently inhibited ligand binding (IC(50)=3.0nM), ligand-induced Ca(2+) flux (IC(50)=5.4nM), and the chemotaxis of human CCR3-expressing cells (IC(50)=19.9nM). PMID: 16343433
  22. Eosinophils, through CCR3, play a central role in chronic allergic airway disease. PMID: 17060636
  23. In the absence of eotaxin-2 or CCR3, we observed a significant reduction in IL-13-induced eosinophil recruitment into the lung lumen. IL-13 transgenic mice deficient in CCR3 exhibited a 98% reduction in lung eosinophils. PMID: 17148674
  24. Agonists and antagonists of CCR3 appear to occupy overlapping sites within the transmembrane helical bundle, suggesting a fine line between agonism and antagonism of chemokine receptors. PMID: 17635911
  25. Heligmosomoides infection resulted in a reduction in lung eosinophil count, decreased eotaxin levels in bronchoalveolar lavage fluid, lowered CCR3 receptor expression on eosinophils, and impaired chemotaxis of these cells towards eotaxin. PMID: 17650182
  26. In knockout mice, immediate hypersensitivity reactions in the conjunctiva are ablated despite normal tissue mast cell numbers and IgE levels. PMID: 19147836
  27. Genetic or pharmacological targeting of CCR3 or eotaxins inhibited injury-induced choroidal neovascularization in mice. PMID: 19525930

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in skeletal muscle and in trace amounts in leukocytes.

Q&A

What is the molecular structure of mouse CCR3 and how does it compare to human CCR3?

Mouse CCR3 is a seven-transmembrane G protein-coupled receptor encoded by the gene located on chromosome 9. The mouse CCR3 protein consists of 359 amino acids (Met1-Phe359) and has an accession number of P51678 . While mouse and human CCR3 share significant homology, there are species-specific differences that researchers should consider when designing experiments or interpreting results from mouse models.

Mouse CCR3 has evolved as part of the inflammatory chemokine receptor (iCCR) family, which includes CCR1, CCR2, and CCR5. These receptors show selective expression patterns in individual cell types, contradicting earlier assumptions about extensive functional redundancy . When developing antibodies or designing targeting strategies, it's crucial to account for the high degree of homology between different iCCRs, which can lead to non-specific binding if proper controls aren't used .

Which cell types express CCR3 in mice and how is this expression regulated?

In mice, CCR3 is predominantly expressed on:

  • Eosinophils (highest expression)

  • Basophils

  • Mast cells

  • Subsets of dendritic cells

  • Certain T helper cell populations

CCR3 expression is dynamically regulated during immune responses. Flow cytometry analysis of mouse splenocytes has confirmed CCR3 expression on specific cell populations, particularly when co-stained with markers like Gr-1/Ly-6G . The regulation of CCR3 expression involves both transcriptional and post-transcriptional mechanisms, including cytokine-mediated induction and receptor internalization following ligand binding.

Recent studies using transgenic reporter mice have revealed that CCR3 expression patterns are more selective than previously anticipated, with specific expression profiles in resting and inflammatory conditions . This selective expression suggests limited functional redundancy with other chemokine receptors, highlighting CCR3's distinct role in immune cell trafficking.

What are the most reliable methods for detecting CCR3 expression in mouse samples?

Several methodological approaches can be used to detect CCR3 expression, each with specific advantages:

Flow Cytometry:

  • Fluorescein-conjugated antibodies (e.g., Clone #83101) allow for specific detection of CCR3 on cell surfaces

  • When analyzing tissues, proper gating strategies and appropriate isotype controls are essential

  • For optimal results, use freshly isolated cells as enzyme digestion can cleave the external portions of chemokine receptors, preventing antibody detection

Reporter Systems:

  • Transgenic iCCR reporter (iCCR-REP) mice expressing spectrally distinct fluorescent proteins for CCR3 and other receptors provide superior specificity compared to antibody-based detection

  • These systems allow simultaneous tracking of multiple chemokine receptors without antibody staining artifacts

Quantitative PCR:

  • Useful for detecting CCR3 mRNA levels

  • Should be complemented with protein detection methods due to potential post-transcriptional regulation

Important methodological consideration: Commercial antibodies for chemokine receptors frequently show background non-specific staining due to the high homology between different iCCRs. Researchers should always include appropriate knockout controls (e.g., CCR3-deficient mice) when validating antibody specificity .

How can CCR3-mediated migration be effectively measured in vitro?

The assessment of CCR3-mediated migration is critical for understanding receptor functionality. The following methodological approaches are recommended:

Transwell Migration Assay:

  • Place CCR3-expressing cells in the upper chamber and chemokines (e.g., eotaxin-1 at 100 nM) in the lower chamber

  • Quantify migration as either percent cell migration relative to control or as average number of cells per field

  • Include appropriate controls, such as cells with receptor antagonists or cells from receptor-deficient mice

Microfluidic Devices:

  • Allow for the measurement of migration toward both substrate-bound and soluble chemokine gradients

  • Provide more physiologically relevant conditions than traditional Transwell assays

Chemotaxis Analysis Workflow:

  • Isolate target cells (e.g., bone marrow-derived eosinophils)

  • Confirm CCR3 expression by flow cytometry

  • Prepare chemokine dilutions (typically 1-100 nM range)

  • Conduct migration assay (2-4 hours for optimal results)

  • Quantify migrated cells and calculate migration index

As demonstrated in studies with Galectin-3 deficient eosinophils, CCR3-mediated migration toward eotaxin-1 can be significantly affected by molecular interactors, highlighting the importance of comprehensive controls in migration experiments .

How can transgenic CCR3 reporter mice advance our understanding of inflammatory processes?

The development of transgenic iCCR reporter mice has revolutionized the study of chemokine receptor dynamics in vivo. These systems offer several key advantages for inflammatory research:

Temporal and Spatial Tracking:

  • iCCR-REP mice expressing spectrally distinct fluorescent reporters for CCR1, CCR2, CCR3, and CCR5 allow for precise tracking of receptor expression during inflammatory responses

  • These systems enable visualization of receptor expression changes in real-time as cells migrate from bone marrow to blood and into inflamed tissues

Combinatorial Expression Analysis:

  • Reporter mice reveal the precise combinations of chemokine receptors expressed by individual cells

  • This allows researchers to identify specific cellular subpopulations and their changing receptor profiles during differentiation and activation

Unbiased Assessment of Receptor Dynamics:

  • Unlike antibody-based detection, reporter systems are not affected by receptor internalization or cleavage during tissue processing

  • This provides more accurate data on receptor expression patterns in various physiological and pathological states

Research Applications:

  • Tracking myeloid cell recruitment during acute and chronic inflammation

  • Analyzing the hierarchy of chemokine receptor expression during differentiation

  • Identifying target cell populations for therapeutic interventions

The iCCR-REP mouse strain has demonstrated that chemokine receptor expression is highly specific and more selective than previously anticipated, challenging the notion of extensive redundancy in the chemokine system .

What are the key considerations when designing experiments with CCR3-deficient mice?

When working with CCR3-deficient mice, researchers should consider several critical factors to ensure experimental validity and reproducibility:

Genetic Background Effects:

  • Ensure CCR3-deficient mice and controls are on the same genetic background

  • Different mouse strains can exhibit varying baseline levels of eosinophils and other CCR3-expressing cells

Compensatory Mechanisms:

  • CCR3-deficient mice may develop compensatory upregulation of other chemokine receptors

  • Assess expression of related receptors (CCR1, CCR2, CCR5) to identify potential compensation

Phenotyping Protocol:

  • Confirm CCR3 deletion by genotyping

  • Assess baseline hematopoietic parameters in bone marrow, blood, and tissues

  • Evaluate functional responses (e.g., migration to CCR3 ligands) in isolated cells

  • Compare inflammatory responses in disease models

Experimental Controls:

  • Include both wild-type littermates and heterozygous animals when possible

  • For experiments using the iCCR-REP system, proper controls would include animals derived from heterozygous crosses as mentioned in the literature

CCR3-deficient mice have been invaluable in demonstrating the non-redundant functions of this receptor in various inflammatory models, particularly in allergic inflammation and eosinophil trafficking.

How does CCR3 coordinate with other chemokine receptors during inflammatory responses?

CCR3 functions within a complex network of chemokine receptors that orchestrate leukocyte trafficking. Recent research using iCCR reporter mice has provided new insights into how these receptors coordinate:

Hierarchical Expression Patterns:

  • Analysis of iCCR-REP mice has revealed that chemokine receptors display selective expression patterns in individual cell types during both resting and inflammatory states

  • This selectivity suggests that each receptor plays a non-redundant role in leukocyte recruitment

Temporal Coordination:

  • Different chemokine receptors are activated at distinct phases of the inflammatory response

  • CCR3 is particularly important during allergic inflammation, while CCR2 often dominates in monocyte recruitment during bacterial infections

Functional Specialization:

  • CCR3's primary function involves eosinophil recruitment and activation

  • Other iCCRs like CCR2 are more critical for monocyte trafficking

  • This specialization contradicts earlier assumptions about extensive functional redundancy

Cell-Specific Expression Profiles:

  • Using iCCR-REP mice, researchers have demonstrated that bone marrow, peripheral blood, and tissue-resident myeloid cells express distinct patterns of chemokine receptors

  • These expression patterns change dynamically during inflammatory responses

What is the relationship between CCR3 expression and cellular migration capacity?

The relationship between CCR3 expression levels and migration capacity is complex and depends on multiple factors:

Direct Correlation Studies:

  • Research using fluorescein-conjugated anti-CCR3 antibodies has demonstrated that CCR3 expression levels on eosinophils directly correlate with their migration capacity toward CCR3 ligands like eotaxin-1

  • For example, Galectin-3 deficient eosinophils show both decreased CCR3 expression and reduced migratory capacity toward eotaxin-1 (100 nM)

Receptor Density Effects:

Post-Receptor Signaling Efficiency:

  • Migration capacity depends not only on receptor expression but also on the efficiency of downstream signaling pathways

  • Different cell types may exhibit varying migratory responses despite similar CCR3 expression levels

Experimental Migration Data:

Cell TypeCCR3 ExpressionMigration to Eotaxin-1 (100 nM)Reference
WT Eosinophils++100% (baseline)
Gal-3-/- Eosinophils+Significantly decreased
WT Eos + Lactose++Reduced compared to control
WT Eos + Maltose++Similar to control

These findings highlight the important role of CCR3 expression in determining cellular migration capacity and identify molecular regulators like Galectin-3 that can influence this relationship .

How can CCR3 research in mouse models inform therapeutic approaches for human inflammatory diseases?

Mouse models of CCR3 function have provided valuable insights that inform therapeutic strategies for human inflammatory conditions:

Translational Relevance:

  • Despite some species differences, the core functions of CCR3 in eosinophil trafficking are conserved between mice and humans

  • Mouse models have helped identify key pathways and molecular interactions that can be targeted therapeutically

Disease-Specific Insights:

  • In allergic asthma models, CCR3 blockade reduces eosinophil recruitment to the lungs

  • In atopic dermatitis models, CCR3 antagonism decreases skin inflammation

  • These findings have supported the development of CCR3 antagonists for human allergic diseases

Methodological Considerations for Translational Research:

  • Use multiple mouse models that recapitulate different aspects of human disease

  • Validate findings using human cells and tissues when possible

  • Consider species differences in ligand-receptor interactions

  • Employ reporter systems like iCCR-REP mice to track receptor dynamics in vivo

Therapeutic Targeting Approaches:

  • Direct antagonism of CCR3 using small molecule inhibitors

  • Biological therapies targeting CCR3 ligands

  • Cell-specific delivery strategies that modulate CCR3 expression

The development of iCCR reporter mice has provided unprecedented ability to track chemokine receptor expression dynamics in vivo, offering new opportunities for testing targeted therapeutics and understanding their mechanisms of action in inflammatory conditions .

What methodological approaches are most effective for studying CCR3 in complex inflammatory models?

Studying CCR3 in complex inflammatory models requires integrated methodological approaches:

Multiparameter Analysis:

  • Combine flow cytometry with CCR3 reporter systems to simultaneously track multiple parameters

  • Use spectral flow cytometry to analyze complex combinations of iCCR expression on diverse cell populations

Tissue-Specific Considerations:

  • When isolating cells from inflamed tissues, enzymatic digestion can cleave external portions of chemokine receptors, hampering antibody detection

  • Reporter mice circumvent this issue by expressing fluorescent proteins that remain detectable after tissue processing

Temporal Analysis Protocol:

  • Establish baseline CCR3 expression in resting state

  • Induce inflammation using appropriate stimulus

  • Collect samples at multiple time points (early, peak, and resolution phases)

  • Track changes in CCR3 expression and CCR3+ cell populations

  • Correlate with functional outcomes and disease parameters

Integration of Genetic and Pharmacological Approaches:

  • Compare CCR3-deficient mice with wild-type animals treated with CCR3 antagonists

  • This helps distinguish between developmental effects of receptor absence versus acute inhibition

Advanced Imaging Techniques:

  • Intravital microscopy using iCCR-REP mice allows for real-time visualization of CCR3+ cell trafficking in vivo

  • Two-photon microscopy enables deeper tissue imaging with reduced photobleaching

By implementing these methodological approaches, researchers can gain more comprehensive insights into the complex role of CCR3 in inflammatory processes and identify potential therapeutic targets with greater precision.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.