Recombinant Mouse Probable E3 ubiquitin-protein ligase RNF217 (Rnf217)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Rnf217; Ibrdc1; E3 ubiquitin-protein ligase RNF217; IBR domain-containing protein 1; RING finger protein 217
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-515
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf217
Target Protein Sequence
MGEEQSTVSGSGGARASGGGSAGQPESPRPRGDRVRTAGPRAAASSSRPNGGGGGRDPGC VDASVQEPASNRAPAGQPARLPLSGPLDPQSLELQLEREAEGAGPREAPPGQQPPDGLLL DVLAQRHPPPAKPQVLCSVYCVESDLPEAPSAESPSPSESPPQAPLGPIPASPPPSFPSS PLSLPADPLSPDGGSIELEFYLAPEPFSVPGLLGAPPYSGLGGVGDPYAPLMVLMCRVCL EDKPIKPLPCCKKAVCEECLKIYLSSQVQLGQVEIKCPVTECFEFLEETTVVYNLTHEDS IKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESRYKIQCPTCQLIWCFKCH SPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTN FCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVRGSVCAGKLFIAPLILVL GLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMHW
Uniprot No.

Target Background

Function
RNF217 is an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes via a thioester linkage. It directly transfers ubiquitin to target substrates, mediating the degradation of the iron exporter ferroportin/SLC40A1 and thus regulating iron homeostasis.
Database Links
Protein Families
RBR family, RNF217 subfamily
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is the primary function of RNF217 in iron homeostasis?

RNF217 functions as an E3 ubiquitin ligase that mediates the degradation of ferroportin (FPN), the only known cellular iron exporter. This degradation mechanism is essential for maintaining proper intracellular and systemic iron homeostasis . The degradation process occurs through ubiquitination, where RNF217 catalyzes the addition of ubiquitin molecules to FPN, marking it for proteolytic degradation. This mechanism represents a critical control point in cellular iron export, as FPN is the sole pathway through which iron exits cells .

How is RNF217 expression regulated at the epigenetic level?

RNF217 expression is regulated by Tet1-mediated DNA demethylation. Tet1 (ten-eleven translocation methylcytosine dioxygenase 1) is an enzyme that converts 5-methylcytosine (5-mC) to 5-hydroxymethylcytosine (5-hmC), effectively removing methyl groups from DNA . This epigenetic modification occurs specifically at the Rnf217 promoter region, where Tet1 activity leads to demethylation and subsequent upregulation of Rnf217 expression . The iron-responsive nature of this regulation creates a feedback mechanism where iron status can influence RNF217 levels and consequently modulate iron export through FPN degradation .

What phenotypes are observed in Rnf217 knockout models?

Conditional knockout of Rnf217 produces tissue-specific effects on iron homeostasis:

  • In macrophage-specific Rnf217 knockout mice (using Lysm-Cre), there is increased splenic iron export due to stabilization of FPN in macrophages

  • In intestinal cell-specific Rnf217 knockout mice (using Villin-Cre), increased iron absorption is observed

  • These tissue-specific effects highlight the cell type-dependent role of RNF217 in regulating iron homeostasis

The table below summarizes the phenotypic changes observed in different Rnf217 knockout models:

Knockout ModelTissue/Cell TypeObserved PhenotypeMolecular Mechanism
Lysm-Cre Rnf217MacrophagesIncreased splenic iron exportStabilization of FPN
Villin-Cre Rnf217Intestinal enterocytesIncreased iron absorptionStabilization of FPN

What is the relationship between RNF217 and Tet1 in iron metabolism?

The relationship between RNF217 and Tet1 represents a novel iron-responsive regulatory axis. Loss of Tet1 expression results in:

  • Accumulation of FPN protein due to reduced RNF217-mediated degradation

  • Impaired response to iron overload conditions

  • Abnormal iron distribution characterized by:

    • Increased iron accumulation in the liver

    • Decreased iron levels in the spleen and duodenum

This Tet1-RNF217-FPN axis serves as a critical regulatory mechanism that responds to changes in iron status, allowing for adaptive modifications in iron export to maintain systemic iron homeostasis .

What is the molecular mechanism by which RNF217 mediates FPN degradation?

RNF217 mediates FPN degradation through a specific ubiquitination process:

  • RNF217 directly binds to FPN, as demonstrated through co-immunoprecipitation assays using protein A/G beads conjugated with Myc or Flag antibodies

  • Following binding, RNF217 catalyzes the poly-ubiquitination of FPN, which can be detected using the FK2 anti-poly-Ub antibody after immunoprecipitation with anti-FPN antibody

  • This poly-ubiquitination serves as a signal for proteasomal degradation of FPN

  • Mutation of specific residues in RNF217 can attenuate its ability to ubiquitinate and degrade FPN, confirming the specificity of this mechanism

The process represents a post-translational regulatory mechanism distinct from the well-established hepcidin-induced FPN internalization pathway, providing an additional layer of control over iron export.

How does the Tet1-RNF217-FPN axis respond to iron overload conditions?

Under iron overload conditions, the Tet1-RNF217-FPN axis exhibits a coordinated response:

  • Iron status influences Tet1 activity, as Tet1 itself requires iron as a cofactor for its enzymatic function

  • Activated Tet1 promotes demethylation of the Rnf217 promoter, increasing RNF217 expression

  • Elevated RNF217 levels enhance FPN ubiquitination and degradation

  • Reduced FPN expression at the cell surface limits cellular iron export

  • This adaptive response helps protect cells from iron overload-induced toxicity

In Tet1 knockout mice challenged with iron overload, this protective mechanism is impaired, resulting in:

  • Abnormal iron distribution across tissues

  • Increased iron accumulation in the liver

  • Reduced iron levels in the spleen and duodenum

This demonstrates that the Tet1-RNF217-FPN axis is critical for maintaining iron homeostasis under stress conditions.

What is the functional significance of RNF217-AS1 and how does it relate to RNF217?

RNF217-AS1 is an antisense transcript of RNF217 that possesses peptide-coding potential despite being initially classified as a long non-coding RNA (lncRNA) . Recent research has revealed:

  • RNF217-AS1 contains a functional open reading frame (ORF3) that encodes a short peptide

  • This peptide demonstrates significant biological activity:

    • Inhibits squamous cell carcinoma (SC) progression in vitro and in vivo

    • Suppresses macrophage recruitment and pro-inflammatory responses in SC

    • Reduces expression of proliferation markers (PCNA, Ki67) and invasion markers (MMP9)

  • The relationship between RNF217-AS1-encoded peptide and RNF217 protein function represents a complex regulatory system that may coordinate iron metabolism with inflammatory responses

This discovery highlights the multifaceted nature of the RNF217 locus, suggesting potential regulatory interactions between RNF217 and its antisense transcript that may influence iron homeostasis in specific pathophysiological contexts.

How does RNF217 function differ in various cell types and what are the implications for systemic iron homeostasis?

RNF217 exhibits distinct cell type-specific functions that collectively regulate systemic iron homeostasis:

  • In macrophages:

    • RNF217 regulates iron release from macrophages by controlling FPN stability

    • Macrophage-specific knockout (Lysm-Cre) increases FPN levels and promotes iron export from splenic macrophages and bone marrow-derived macrophages (BMDMs)

    • This affects the recycling of iron from senescent erythrocytes, a major source of systemic iron

  • In intestinal enterocytes:

    • RNF217 modulates dietary iron absorption by regulating FPN levels at the basolateral membrane

    • Intestinal-specific knockout (Villin-Cre) appears to increase iron absorption through stabilization of FPN

    • This influences the entry of dietary iron into the circulation

  • In hepatocytes:

    • The interaction with hepcidin-induced FPN degradation remains to be fully characterized

    • Potential synergistic or compensatory mechanisms may exist between hepcidin and RNF217-mediated FPN regulation

The cell type-specific functions create a coordinated network for maintaining iron balance across different tissue compartments, with therapeutic implications for disorders of iron metabolism.

What are the optimal strategies for generating and validating recombinant mouse RNF217?

To generate and validate recombinant mouse RNF217 for research applications:

  • Expression vector selection:

    • pCMV-3Tag-3A vector with a Flag tag has been successfully used for RNF217 expression

    • This system allows for detection and purification of the recombinant protein

  • Expression system options:

    • HEK293T cells provide a mammalian expression system that supports proper folding and post-translational modifications

    • Bacterial expression systems can be used for structural studies but may require refolding protocols

  • Validation strategies:

    • Western blot analysis using anti-Flag or specific anti-RNF217 antibodies

    • Functional validation through in vitro ubiquitination assays with purified components

    • Co-immunoprecipitation with known binding partners (e.g., FPN) to confirm interaction capacity

  • Quality control parameters:

    • Assess enzymatic activity using in vitro ubiquitination assays

    • Verify protein purity through SDS-PAGE and mass spectrometry

    • Confirm proper folding through circular dichroism or limited proteolysis

What experimental models are most suitable for studying RNF217 function in iron homeostasis?

Multiple experimental models have proven valuable for investigating RNF217 function:

  • Cell culture models:

    • Bone marrow-derived macrophages (BMDMs) provide a primary cell system for studying macrophage iron metabolism

    • HEK293T cells serve as an effective system for protein overexpression and interaction studies

    • Cell lines can be treated with iron compounds or chelators to study iron-responsive regulation

  • Mouse models:

    • Global Tet1 knockout mice provide insights into the upstream regulation of RNF217

    • Conditional knockout models using tissue-specific Cre drivers:

      • Lysm-Cre for macrophage-specific deletion

      • Villin-Cre for intestinal enterocyte-specific deletion

    • These models allow for the assessment of tissue-specific functions in vivo

  • Experimental conditions:

    • Low-iron diet (2 weeks) to suppress endogenous hepcidin levels

    • Iron challenge protocols to assess response to iron overload

    • Hepcidin injection (20 μg in 0.1 mL saline) to study interaction with hepcidin-mediated regulation

    • LPS injection (5 μg/g body weight) to investigate inflammatory responses

What analytical methods are most effective for assessing RNF217-mediated FPN ubiquitination?

To effectively assess RNF217-mediated FPN ubiquitination:

  • Co-immunoprecipitation approach:

    • Co-transfect cells with FPN-Myc and RNF217-Flag constructs

    • Immunoprecipitate using protein A/G beads conjugated with Myc or Flag antibodies

    • Perform immunoblotting with the reciprocal antibody to confirm interaction

  • Ubiquitination detection methods:

    • For cell lines: Overexpress FPN-Myc, immunoprecipitate, and immunoblot with FK2 anti-poly-Ub antibody

    • For primary cells (BMDMs): Immunoprecipitate endogenous FPN and immunoblot with FK2 antibody

    • Treatment with proteasome inhibitors (e.g., MG132) can enhance detection of ubiquitinated species

  • Mutational analysis:

    • Generate RNF217 mutants affecting catalytic activity

    • Assess impact on FPN ubiquitination to identify critical residues

    • Compare wild-type and mutant RNF217 in rescue experiments

  • Quantification approaches:

    • Western blot densitometry with normalization to input controls

    • Mass spectrometry-based approaches to identify specific ubiquitinated lysine residues

    • Statistical analysis using Student's t-test or one-way ANOVA with Tukey's post hoc test

What considerations are important when designing studies to investigate the iron-responsive regulation of the Tet1-RNF217-FPN axis?

When investigating iron-responsive regulation of the Tet1-RNF217-FPN axis:

  • Experimental design considerations:

    • Include time-course analyses to capture dynamic responses

    • Implement dose-response studies with iron compounds or chelators

    • Account for potential tissue-specific differences in response patterns

    • Include appropriate controls for each experimental condition

  • Iron manipulation strategies:

    • Iron loading: ferric ammonium citrate or iron dextran treatment

    • Iron depletion: iron chelators (deferoxamine, deferiprone) or low-iron diet

    • Inflammatory challenges: LPS injection to induce hepcidin-mediated changes

    • Combined approaches to distinguish direct iron effects from hepcidin-mediated effects

  • Analytical endpoints:

    • Gene expression: qRT-PCR for Tet1, Rnf217, and Fpn1 mRNA levels

    • Protein levels: Western blot analysis of TET1, RNF217, and FPN

    • Epigenetic analysis: Bisulfite sequencing or methylation-specific PCR of the Rnf217 promoter

    • Functional assessment: Cellular iron content using ferrozine assay or Prussian blue staining

    • Tissue iron distribution: Perl's Prussian blue staining of tissue sections

  • Statistical considerations:

    • Minimum of three biological replicates with three technical replicates each

    • Appropriate statistical tests (t-test or ANOVA with post-hoc analysis)

    • Statistical significance threshold of P < 0.05

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.