Recombinant Mouse Probable G-protein coupled receptor 153 (Gpr153)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly equipped with blue ice packs. If dry ice packaging is required, please contact us in advance, as additional fees may apply.
Note: All protein shipments are standardly equipped with blue ice packs. If dry ice packaging is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr153; Pgr1; Probable G-protein coupled receptor 153; G-protein coupled receptor PGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-631
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSDERRLPSSAVGWLACGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVP
IATYAVVQLRRQRPDYEWNEGLCKVFVSTFYTLTLATCFSVTSISYHRMWMVRWPVNYRL
SNAKKQAVHTVMGIWMVSFILSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLV
GGSVAMGMVCTAIALFQTLATQVGHRADRRTFTVPTIVVEDAQGKRRSSIDGSEPARTSL
QITGLVATIVVIYDCLMGFPVLVVSFSSLRADASAPWMALCVLWCSVTQALLLPLFLWTC
DRYRADLKAVWEKCVALMANDEDSDNETSLEGSISPDMVLERSLDYSYGGDFVALDRMAK
YELSALEGGLPQLYPLRPLQEDRMQYLQGAGRHRCGFPGGQPCFSPAGCSQVPPTRRFSH
DDADVWAAVPLPTFLPRWSSGEDLAALAHLMLPAGSDRRRGSLLAFAEDAPPFRPRRRSA
ESLLSLQPSSLDGGPRHAQDSPPGSPRRRPGPGARSASVSLLPDAFALTAFEREPQALRR
VPAPAQPFPAARDSAEPAEVPTPPGGRTQRSQGRRAARTHVGPLQSSLSASWGEPGGLHA
AGCGSISSFLSSPSESSGYVTLHSDSLGSAS
Uniprot No.
Target Background
Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
