Recombinant Mouse Probable G-protein coupled receptor 156 (Gpr156)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr156; Gababl; Probable G-protein coupled receptor 156; GABAB-related G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-798
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITESQHSSTAASPLSPALLGIMWTFLSCG LLLVLFFLAFTIRCRKNRIVKMSSPNLNVVTLLGSCLTYISAYLFGIQDALEGSSVEALI QTRLSLLCIGTSLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILL VTWVLTDPIQCLQMLGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGA YLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT TTVNCCVFIPQLKQWKAFEGENQTMRHMAKYFSTPSKSFHSQFDEDPSCHLRDEKSCMER LLTEKNAVIESLQEQVSNAKEKLVKLMSAECTYDSPEWAVPDAASARGLALPGPSECPAV SENESGAAARDSLHVPAACQHVQGPGASRRDTSPSPAQQDNMPLKQYCDHLDTGCNQKPK AEQSEGPERGDQEPMAPSQRLMADGVACEPHKPRQSPEGLPKKLPGVSSVVREKLQEVLQ ELDLGSEAPLSPLPCPQQLWKSTTSRSPQKLSPSKLGFSPYVVRRRRAAQRARSHIPGSV GLNVGHQANSTVSSSQSGLIVQNRDSPRLDHHNARSKVPRSSSVKPSPLSEPRRKQGTLE GSKQCETEPQEAGGACNVAFPCQSSASVQAQSPAAPCLPSSPALPRQRQPRPRLSPGCPS LSSGCYNLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQASGLASWEKLW ARSKPVVNFKDDLKPTLV
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse GPR156 and how does it differ from typical class C GPCRs?

Mouse GPR156 is a class C orphan G-protein-coupled receptor that notably lacks the large extracellular Venus flytrap (VFT) domain typical of other class C GPCRs. Instead, it possesses a distinctively short N-terminal sequence (approximately 45 residues) that is insufficient to form the extensive extracellular region characteristic of its class C counterparts. The structure features a homodimer with an unusual interface located between transmembrane helices 5 and 6 (TM5 and TM6) of both GPR156 subunits. Unlike other class C GPCRs, both subunits of GPR156 exhibit nearly identical conformations, maintaining an active state configuration even without ligand binding . This structural arrangement likely accounts for its high constitutive activity and plays a critical role in its functional properties within auditory systems .

What is known about GPR156's constitutive activity and signaling pathways?

GPR156 exhibits high constitutive activity primarily through Gi protein coupling. Cryo-electron microscopy studies have revealed that both subunits in the apo GPR156 homodimer maintain active-state conformations similar to the GABAB2(G) subunit, differing significantly from inactive GABAB2 configurations. Key residues including K1413.50, R1443.53, S842.35, and F1353.44 substantially impact this basal activity . The C-terminus of GPR156 plays a dual functional role - promoting G protein binding within the G-bound subunit while simultaneously preventing the G-free subunit from binding to additional G proteins . This mechanism explains how GPR156 activity is maintained through dimerization and provides insight into its sustained role in auditory function maintenance. The GPR156-Gi signaling pathway is essential both during auditory development and after hearing maturity, with appropriate expression levels being crucial for normal auditory function .

How is mouse GPR156 gene structure organized and what are its key identifiers?

The mouse GPR156 gene (official symbol: Gpr156) is identified by NCBI Gene ID 239845. Its mRNA reference sequence is NM_153394.2, corresponding to protein reference sequence NP_700443.2. The protein is cataloged in UniProt with ID Q6PCP7. An alternative name for GPR156 is Gababl, reflecting its structural similarity to GABAB receptors despite being functionally distinct . The gene encodes a full-length protein that contains the characteristic seven-transmembrane domain structure of GPCRs but with the notable absence of the large extracellular domain typical of class C receptors. Understanding these identifiers is essential for researchers designing expression constructs, developing targeting strategies, or conducting database searches related to GPR156 research .

How does GPR156 dysfunction contribute to hearing impairments?

GPR156 dysfunction significantly impacts hearing through multiple mechanisms affecting cochlear development and function. When GPR156 expression is reduced or eliminated, improper stereocilium deflection occurs in hair cells during development, disrupting the mechanical-to-electrical transduction process essential for sound detection . In mature auditory systems, GPR156 knockdown results in severe hearing loss correlated with partial loss of hair cells and synapses . The high constitutive activity of GPR156 through Gi protein coupling appears to be crucial for maintaining normal hair cell function and survival. Disruption of this signaling pathway likely alters ion homeostasis, synaptic function, or cellular metabolism within the inner ear. These findings suggest that GPR156 mutations or expression abnormalities could potentially underlie certain forms of congenital hearing impairments or progressive hearing loss . Understanding the precise mechanisms by which GPR156 maintains auditory function could provide targets for therapeutic interventions aimed at preserving hearing in affected individuals .

What are the optimal methods for expressing and purifying recombinant mouse GPR156?

To effectively express and purify recombinant mouse GPR156, a mammalian expression system is strongly recommended due to the complex folding and post-translational modifications required for proper GPCR function. Based on established protocols, the following methodological approach is optimal:

  • Expression System: Use mammalian cells (typically HEK293 or CHO cells) for expression to ensure proper protein folding and processing .

  • Construct Design: Include a C-terminal His-tag for purification purposes. Consider incorporating stabilizing mutations if studying the protein structurally .

  • Transfection and Culture: Transiently transfect cells using lipofection or polyethylenimine methods. Culture for 48-72 hours post-transfection for optimal protein expression .

  • Membrane Preparation: Harvest cells and prepare membranes through homogenization and centrifugation steps to concentrate the receptor.

  • Solubilization: Solubilize membranes using appropriate detergents (such as DDM, LMNG, or GDN) that maintain protein stability and activity.

  • Purification Steps:

    • IMAC purification using Ni-NTA or similar resin

    • Size exclusion chromatography for final purification and buffer exchange into PBS buffer

  • Storage: Store purified protein at +4°C for short-term use or at -20°C to -80°C for long-term storage .

Achieving >80% purity is standard for research applications . For structural studies requiring GPR156-G protein complexes, additional steps include incubating the concentrated sample with scFv16 at 4°C before final chromatography .

What are the most effective tools for studying GPR156 function in auditory systems?

Investigating GPR156 function in auditory systems requires a multifaceted approach combining molecular, cellular, and physiological techniques:

  • In Vivo Knockdown/Knockout Models:

    • AAV-mediated shRNA delivery through the round window membrane has proven effective for temporal and spatial control of GPR156 expression in cochlear hair cells

    • CRISPR/Cas9-mediated knockout models for complete elimination of GPR156 expression

  • Functional Auditory Assessment:

    • Auditory Brainstem Response (ABR) testing to quantify hearing thresholds

    • Distortion Product Otoacoustic Emissions (DPOAE) to assess outer hair cell function

  • Cellular Analysis:

    • Immunohistochemistry to visualize stereocilium morphology and orientation

    • Confocal microscopy for detailed structural analysis of hair cells

    • Scanning electron microscopy for high-resolution imaging of stereocilia bundles

  • Molecular Assessment:

    • RT-qPCR to quantify GPR156 knockdown efficiency (approximately 50% reduction achieved with effective shRNA)

    • Western blotting to assess protein expression levels

  • Signaling Pathway Analysis:

    • G protein coupling assays to measure constitutive activity

    • cAMP accumulation assays to assess Gi protein signaling

    • Calcium imaging for downstream signaling analysis

Timing interventions at specific developmental stages (P2-P3 for development, P30 and P60 for mature function) provides insight into the temporal requirements for GPR156 function .

How can siRNA approaches be optimized for GPR156 research?

Optimizing siRNA approaches for GPR156 research requires careful consideration of multiple factors to achieve effective and specific gene silencing:

  • siRNA Design Principles:

    • Target unique regions of GPR156 mRNA (NM_153394.2) to avoid off-target effects

    • Maintain GC content between 30-60% for optimal binding efficiency

    • Avoid sequences with internal repeats or palindromes

    • Design multiple siRNA candidates targeting different regions of the transcript

  • Delivery Methods:

    • For in vitro studies: Lipid-based transfection reagents typically achieve 70-90% transfection efficiency in cultured cells

    • For in vivo studies: AAV-mediated shRNA delivery through the round window membrane has demonstrated approximately 50% knockdown efficiency at the transcriptional level

  • Validation Strategies:

    • Quantify knockdown efficiency using RT-qPCR

    • Confirm protein reduction through Western blotting or immunofluorescence

    • Include scrambled siRNA controls to distinguish specific from non-specific effects

    • Use multiple independent siRNAs to confirm phenotypes are due to GPR156 knockdown rather than off-target effects

  • Temporal Considerations:

    • For developmental studies, administer at P2-P3

    • For mature auditory function analysis, administer at P30 or P60

    • Plan experiment duration based on the half-life of GPR156 protein and the expected timeline of phenotypic changes

  • Functional Assessment:

    • Correlate degree of knockdown with phenotypic changes

    • Implement rescue experiments with siRNA-resistant GPR156 constructs to confirm specificity

This methodological approach has successfully achieved approximately 50% reduction in GPR156 expression, sufficient to induce significant functional changes in auditory systems while avoiding potential compensatory mechanisms that might occur with complete knockout .

How does the unique dimeric structure of GPR156 influence its constitutive activity compared to other class C GPCRs?

The constitutive activity of GPR156 is intimately linked to its unique dimeric structure, which differs substantially from other class C GPCRs. Cryo-EM studies at 3.09 Å resolution for apo GPR156 and 2.39 Å for the GPR156-Gi3 complex have revealed several distinctive structural features that contribute to this constitutive activity :

  • Novel Dimer Interface: Unlike other class C GPCRs that typically form interfaces between VFT domains or involving TM1, TM2, and TM7, GPR156 forms a homodimer with an interface between TM5 and TM6 of both subunits. This arrangement allows both subunits to maintain active conformations simultaneously .

  • Symmetrical Active State: Both subunits in the GPR156 dimer exhibit nearly identical conformations that resemble the active state. Key residues including F1353.44 adopt conformations characteristic of the active state in both subunits, contrasting with the asymmetric activation observed in other class C GPCRs .

  • Structural Stability During G Protein Coupling: Remarkably, comparison between apo GPR156 and the GPR156-Gi3 complex reveals striking similarity (RMSD of 0.539 Å for pruned 572aa), with no interface rearrangement occurring after G protein coupling. This unprecedented stability in class C GPCRs suggests the dimer interface is optimized for constitutive activity .

  • Dual Role of C-terminus: The C-terminus plays a critical role in promoting G protein binding within the G-bound subunit while preventing the G-free subunit from binding additional G proteins, providing a structural basis for regulated constitutive activity .

These structural features collectively explain GPR156's high constitutive activity and suggest an evolutionary adaptation for maintaining tonic Gi signaling required for auditory function maintenance, rather than the dynamic ligand-induced activation seen in other class C GPCRs .

What are the potential molecular mechanisms by which GPR156-mediated signaling maintains hair cell function?

The maintenance of hair cell function through GPR156-mediated signaling likely involves several interconnected molecular mechanisms:

  • Gi Protein Signaling Cascade: GPR156's constitutive coupling to Gi2/3 proteins inhibits adenylyl cyclase activity, reducing intracellular cAMP levels. This modulation of cAMP-dependent pathways appears critical for hair cell homeostasis and function .

  • Ion Channel Regulation: Gi-mediated signaling potentially modulates key ion channels in hair cells, including:

    • Potassium channels that maintain resting membrane potential

    • Calcium channels involved in synaptic transmission

    • Mechanotransduction channels that convert mechanical stimuli to electrical signals

  • Cytoskeletal Organization: The observation that GPR156 knockdown during development causes improper stereocilium deflection suggests involvement in cytoskeletal organization pathways, potentially through regulation of small GTPases like Rac1 and Cdc42 .

  • Synaptic Function Maintenance: Knockdown of GPR156 in mature auditory systems leads to partial loss of synapses, suggesting a role in maintaining synaptic connections between hair cells and spiral ganglion neurons .

  • Cell Survival Signaling: The observed hair cell loss following GPR156 knockdown indicates involvement in anti-apoptotic or pro-survival signaling pathways, potentially through regulation of PI3K/Akt or MAPK signaling cascades .

  • Developmental Polarity Maintenance: GPR156's role in establishing proper stereocilium orientation suggests involvement in planar cell polarity pathways, which may require continued signaling for maintenance in mature systems .

Understanding these molecular mechanisms remains an active area of research, with significant implications for developing therapeutic strategies targeting GPR156-mediated pathways to prevent or treat hearing loss .

How might structural insights into GPR156 inform drug discovery efforts for hearing loss treatment?

The unique structural features of GPR156 revealed through recent cryo-EM studies provide several avenues for rational drug design aimed at treating hearing impairments:

  • Positive Allosteric Modulators (PAMs): The constitutively active nature of GPR156 suggests that PAMs enhancing its activity could potentially restore function in cases where GPR156 expression is reduced but not eliminated. Structure-based design could target the TM5/TM6 dimer interface to stabilize the active conformation .

  • Interface-Targeted Therapeutics: The distinctive TM5/TM6 dimer interface represents a unique druggable pocket not present in other GPCRs. Small molecules binding at this interface could potentially modulate GPR156 activity without affecting other GPCR family members, offering selective therapeutic options .

  • G Protein Coupling Modulators: The structural details of the GPR156-Gi3 complex reveal specific interactions that could be targeted to enhance coupling efficiency. The C-terminus plays a dual role in G protein binding that could be exploited through peptidomimetic approaches .

  • Structure-Based Gene Therapy Design: Structural insights inform the design of GPR156 variants with enhanced stability or activity for gene therapy applications in cases of congenital GPR156 deficiency.

  • Biased Signaling Modulators: Understanding the structural basis of GPR156 signaling could enable the development of biased ligands that selectively activate beneficial signaling pathways while avoiding potentially detrimental ones.

Future drug discovery efforts would benefit from additional structural characterization of GPR156 in various states and with diverse interacting partners. Computational approaches including molecular dynamics simulations and virtual screening against the identified structural features could accelerate the identification of lead compounds for hearing loss treatment .

What are the methodological considerations for developing cellular assays to screen GPR156 modulators?

Developing robust cellular assays for GPR156 modulator screening presents unique challenges due to its constitutive activity and dimeric structure. Key methodological considerations include:

  • Cell Line Selection and Expression System:

    • Use mammalian cell lines with minimal endogenous G protein signaling

    • Consider stable cell lines expressing controlled levels of GPR156 to ensure reproducibility

    • For structure-function studies, HEK293 cells have proven effective for expressing functional GPR156

  • Assay Selection Based on Signaling Pathway:

    • cAMP inhibition assays using bioluminescence resonance energy transfer (BRET) or FRET-based sensors to detect Gi-mediated adenylyl cyclase inhibition

    • GTPγS binding assays to directly measure G protein activation

    • β-arrestin recruitment assays to assess potential biased signaling properties

  • Addressing Constitutive Activity Challenges:

    • Include positive controls with known constitutive activity modulators

    • Design assays with appropriate dynamic range to detect both increases and decreases in the high baseline activity

    • Consider using GPR156 mutants with altered basal activity as reference points

  • Dimerization Considerations:

    • Implement bimolecular fluorescence complementation (BiFC) or FRET-based approaches to monitor effects on dimerization

    • Consider co-expression of differentially tagged GPR156 subunits to assess potential heterodimer formation

  • Validation Approaches:

    • Confirm hits using multiple orthogonal assay technologies

    • Evaluate concentration-response relationships

    • Assess selectivity against related GPCRs

    • Validate in more physiologically relevant models (e.g., cochlear explants)

  • Data Analysis Strategies:

    • Apply appropriate statistical methods accounting for the unique signaling properties of GPR156

    • Consider allosteric modulation models that account for constitutive activity

    • Implement machine learning approaches to identify subtle activity patterns across multiple assay endpoints

These methodological approaches would enable identification of compounds that could potentially enhance or modulate GPR156 activity for therapeutic applications in hearing disorders .

What are the critical knowledge gaps in understanding GPR156 function and regulation?

Despite recent structural and functional insights, several significant knowledge gaps remain in our understanding of GPR156:

  • Endogenous Ligands: Whether GPR156 has endogenous ligands remains unknown. Unlike typical GPCRs, its constitutive activity suggests it may function independently of ligand binding, but potential endogenous modulators cannot be ruled out .

  • Regulatory Mechanisms: The mechanisms regulating GPR156 expression, trafficking, and turnover in hair cells remain poorly characterized. Understanding these processes is crucial for developing strategies to maintain or enhance GPR156 function .

  • Downstream Effectors: While GPR156 couples to Gi proteins, the specific downstream effectors mediating its effects on hair cell function and survival have not been fully elucidated. Identifying these pathways would provide additional therapeutic targets .

  • Species Differences: Most structural work has been performed on human GPR156, while functional studies often use mouse models. Potential species differences in GPR156 structure, function, or regulation require further investigation .

  • Age-Related Changes: Although GPR156 is important for maintaining auditory function in mature mice, whether its expression or function changes with aging remains unknown. This could have implications for age-related hearing loss .

  • Genetic Variations: The potential contribution of GPR156 genetic variants to human hearing disorders has not been systematically investigated. Comprehensive genetic screening in hearing-impaired populations could reveal previously unrecognized mutations .

Addressing these knowledge gaps would significantly advance our understanding of GPR156 biology and potentially lead to novel therapeutic approaches for hearing disorders .

How can advanced structural biology techniques further elucidate GPR156 function?

Advanced structural biology techniques offer promising avenues to further illuminate GPR156 function:

  • Time-Resolved Cryo-EM: While static structures of apo GPR156 and the GPR156-Gi3 complex have been determined at resolutions of 3.09 Å and 2.39 Å respectively , time-resolved cryo-EM could capture conformational intermediates during activation or G protein coupling, providing dynamic insights into GPR156 function.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique could map regions of GPR156 with differential dynamics in various functional states, complementing static structural data by identifying flexible regions important for function.

  • Single-Molecule FRET: Applying single-molecule FRET to purified GPR156 could reveal conformational dynamics and potential heterogeneity not detectable in ensemble structural methods, particularly important given its constitutive activity.

  • Integrative Structural Biology: Combining cryo-EM with molecular dynamics simulations, crosslinking mass spectrometry, and computational modeling would provide a more comprehensive understanding of GPR156 dynamics and interactions.

  • In-Cell Structural Studies: Techniques like cellular cryo-electron tomography could examine GPR156 structure in its native cellular environment, potentially revealing interactions with cellular components not preserved in purified systems.

  • Structure-Function Analysis with Site-Directed Mutagenesis: Systematic mutagenesis of residues identified in structural studies, combined with functional assays, would validate structural insights and identify critical functional determinants.

These advanced approaches would build upon the foundational structural information already obtained, providing deeper mechanistic understanding of GPR156's unique properties and potentially revealing novel targets for therapeutic intervention .

What innovative approaches could be used to develop GPR156-targeted therapeutics for hearing disorders?

Developing GPR156-targeted therapeutics for hearing disorders requires innovative approaches that address the unique challenges presented by this receptor:

  • Structure-Based Virtual Screening:

    • Leverage the high-resolution cryo-EM structures of GPR156 (2.39-3.09 Å) for virtual screening campaigns

    • Focus on the unique TM5/TM6 dimer interface and G protein coupling regions

    • Apply artificial intelligence and machine learning algorithms to identify novel chemical scaffolds with selectivity for GPR156

  • Gene Therapy Approaches:

    • Develop AAV vectors optimized for inner ear delivery, building on successful AAV-shRNA delivery methods

    • Design expression constructs with hair cell-specific promoters for targeted GPR156 expression

    • Explore CRISPR-based approaches for correcting GPR156 mutations or enhancing expression

  • Allosteric Modulator Development:

    • Focus on positive allosteric modulators that enhance constitutive activity rather than orthosteric ligands

    • Design peptides or peptidomimetics targeting the unique dimer interface

    • Develop biased modulators that selectively enhance beneficial signaling pathways

  • Combination Therapies:

    • Identify synergistic approaches combining GPR156 modulation with other hearing loss treatments

    • Explore co-targeting of downstream effectors in the GPR156-Gi signaling pathway

    • Develop protective agents that prevent GPR156 degradation or enhance its stability

  • Novel Delivery Methods:

    • Develop inner ear-specific drug delivery systems such as:

      • Nanoparticle formulations for round window membrane penetration

      • Hydrogel-based sustained release systems for prolonged drug exposure

      • Cell-penetrating peptide conjugates for enhanced intracellular delivery

  • Phenotypic Screening in Physiologically Relevant Models:

    • Establish cochlear organoid systems expressing GPR156

    • Implement high-content screening in hair cell-like cells

    • Develop zebrafish models for medium-throughput in vivo screening

These innovative approaches could overcome the challenges of targeting this uniquely structured and constitutively active receptor, potentially leading to first-in-class therapeutics for congenital and acquired hearing disorders .

Mouse GPR156 Protein Specifications

PropertySpecificationNotes
Gene ID239845NCBI RefSeq
mRNA RefseqNM_153394.2Reference sequence
Protein RefseqNP_700443.2Reference sequence
UniProt IDQ6PCP7Protein database identifier
Expression SystemMammalian CellsOptimal for functional expression
Available TagsHisFor purification purposes
FormLiquid or lyophilized powderFor research applications
Purity>80%Standard research grade
Storage BufferPBS bufferMaintains stability
Storage Conditions+4°C (short term), -20°C~-80°C (long term)For optimal preservation
Endotoxin< 1.0 EU per μgAs determined by LAL method

Data compiled from product specifications and research literature

Functional Consequences of GPR156 Knockdown at Different Developmental Stages

Developmental StageKnockdown MethodHearing PhenotypeCellular EffectsMolecular Effects
P2-P3 (Development)AAV-shRNA1 (~50% KD)Hearing impairmentImproper stereocilium deflectionDisrupted planar cell polarity
P30 (Mature)AAV-shRNA1 (~50% KD)Severe hearing lossPartial hair cell loss, Synapse disruptionAltered Gi signaling
P60 (Late mature)AAV-shRNA1 (~50% KD)Severe hearing lossPartial hair cell lossImpaired hair cell survival

Data synthesized from in vivo experimental results

Structural Comparison of GPR156 with Other Class C GPCRs

FeatureGPR156Typical Class C GPCRs (e.g., GABAB)Functional Significance
N-terminus lengthShort (~45 residues)Long (>400 residues)Absence of VFT domain
Dimer interfaceTM5/TM6-TM5/TM6VFT-VFT or TM1,2,7 basedEnables constitutive activity
Activation symmetrySymmetric (both subunits active)Asymmetric (one active subunit)Enhanced basal signaling
Conformational change upon G protein bindingMinimal (RMSD 0.539 Å)SubstantialStable active conformation
C-terminus roleDual role in G protein couplingSingle roleRegulated constitutive activity

Data derived from structural analyses and comparative studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.