Recombinant Mouse Probable G-protein coupled receptor 160 (Gpr160)

Shipped with Ice Packs
In Stock

Description

Introduction to G-protein Coupled Receptor 160 (Gpr160)

G-protein Coupled Receptor 160 (Gpr160) belongs to the extensive family of G protein-coupled receptors that feature seven transmembrane domains and function by transducing extracellular signals through heterotrimeric G proteins . This receptor has garnered significant attention in recent years due to its potential role in nociception and pain processing. Structurally, Gpr160 is classified as a Class A (Rhodopsin) GPCR according to the standardized GPCR classification system . The significance of this receptor has been highlighted through knockout studies demonstrating its critical involvement in pathological pain states.

The gene encoding Gpr160 in mice is also known by synonyms including 1700025D19Rik and GPCR150, reflecting its historical identification before its function was fully understood . Until recently, Gpr160 remained an orphan receptor with no identified endogenous ligand, limiting understanding of its physiological functions. A significant breakthrough occurred when researchers identified cocaine- and amphetamine-regulated transcript peptide (CARTp) as a potential ligand for Gpr160, effectively "deorphanizing" this receptor and providing crucial insights into its functional role .

Gpr160 knockout mice have been generated using CRISPR-Cas9 genome editing technology to validate the contributions of this receptor in nociceptive behaviors. These knockout mice are healthy, fertile, and show no observable physical abnormalities, suggesting that Gpr160 is not essential for normal development or basic physiological functions . This characteristic makes Gpr160 particularly interesting as a potential therapeutic target, as targeting it may not disrupt essential physiological processes.

Molecular Structure and Characteristics of Mouse Gpr160

The molecular structure of mouse Gpr160 conforms to the canonical GPCR architecture, featuring seven transmembrane helices connected by intracellular and extracellular loops. As a Class A (Rhodopsin) GPCR, it shares structural similarities with other members of this largest and most extensively studied GPCR family . Structure modeling of Gpr160 has revealed varying confidence levels in different regions of the protein, with most areas displaying "very high" to "confident" prediction scores according to AlphaFold pLDDT (predicted Local Distance Difference Test) metrics .

Mouse Gpr160 exists in multiple transcript variants, with transcript variant 1 being commonly used in research applications and commercial products . The full-length protein contains the characteristic GPCR features necessary for ligand binding and signal transduction. Recombinant expression of mouse Gpr160 has been achieved in various systems, including E. coli, yeast, baculovirus, and mammalian cell systems, each offering different advantages for specific research applications .

The structure of Gpr160 is particularly important for understanding its function in nociceptive neurons. The receptor's transmembrane domains form a binding pocket for potential ligands, while intracellular regions interact with G proteins and other signaling molecules. Detailed structural understanding of Gpr160 continues to evolve, with recent advancements in computational modeling providing increasingly accurate predictions of receptor conformation and dynamics.

Functional Role of Gpr160 in Pain Signaling

The functional significance of Gpr160 has been most clearly demonstrated in pain processing pathways. Knockout studies have provided compelling evidence that Gpr160 plays a critical role in the development of pathological pain states while having minimal impact on normal nociception. Gpr160 knockout mice fail to develop behavioral hypersensitivities in models of neuropathic pain caused by constriction of the sciatic nerve, while their responses in hot-plate and tail-flick assays remain unaffected . This selective involvement in pathological pain makes Gpr160 a particularly attractive therapeutic target.

The identification of CARTp as a potential ligand for Gpr160 has further elucidated its functional role. Using Gpr160 knockout mice, researchers demonstrated that the development of behavioral hypersensitivities after intrathecal or intraplantar injections of CARTp is dependent on Gpr160 . This finding establishes a clear link between CARTp signaling and Gpr160 activation in pain processing. Interestingly, although CARTp plays roles in various affective behaviors such as anxiety, depression, and cognition, Gpr160 knockout mice show no differences in learning, memory, or anxiety compared to control mice . This suggests that Gpr160 may mediate specific aspects of CARTp signaling related to nociception, rather than its effects on mood or cognition.

Beyond neuropathic pain, Gpr160 has been implicated in cancer-related pain. Studies have shown that elevated Gpr160 expression in dorsal root ganglion (DRG) neurons contributes to bone cancer pain (BCP) in rodents . The overexpression of Gpr160 in DRG neurons via viral vectors induces nociceptive hypersensitivity to mechanical, heat, and cold stimuli, as well as anxiety-like behavior during evoked responses . These findings further support the pronociceptive role of Gpr160 across multiple pain modalities.

Recombinant Forms of Mouse Gpr160

Recombinant mouse Gpr160 proteins have become essential tools for investigating receptor function, interactions, and potential therapeutic applications. Various expression systems have been employed to produce recombinant Gpr160, each with specific advantages for different research applications. The table below summarizes commercially available recombinant mouse Gpr160 products:

Product CodeDescriptionExpression System
CSB-CF662328MORecombinant Mouse Probable G-protein coupled receptor 160 (Gpr160)in vitro E.coli expression system
CSB-YP662328MO1Recombinant Mouse Probable G-protein coupled receptor 160 (Gpr160), partialYeast
CSB-EP662328MO1Recombinant Mouse Probable G-protein coupled receptor 160 (Gpr160), partialE.coli
CSB-BP662328MO1Recombinant Mouse Probable G-protein coupled receptor 160 (Gpr160), partialBaculovirus
CSB-MP662328MO1Recombinant Mouse Probable G-protein coupled receptor 160 (Gpr160), partialMammalian cell
CSB-EP662328MO1-BRecombinant Mouse Probable G-protein coupled receptor 160 (Gpr160), partialIn Vivo Biotinylation in E.coli
MG215612Gpr160 (tGFP-tagged) - Mouse G protein-coupled receptor 160 (Gpr160) transcript variant 1Expression-ready ORF plasmid

These recombinant proteins vary in design and intended use. Full-length recombinant Gpr160 can be challenging to express due to its transmembrane nature, which is why partial constructs are also commonly used. The choice of expression system significantly affects protein folding, post-translational modifications, and functional properties. E. coli-based systems provide high yield but may lack appropriate post-translational modifications, while mammalian expression systems offer more native-like protein processing but with typically lower yields .

Tagged versions of recombinant Gpr160, such as tGFP-tagged constructs, facilitate detection and localization studies in cellular models . These tagged proteins enable visualization of receptor distribution, trafficking, and co-localization with other cellular components. Expression-ready ORF plasmids allow researchers to transfect cells and study receptor function in various experimental contexts.

Neurophysiological Effects of Gpr160 Modulation

Electrophysiological studies have provided crucial insights into how Gpr160 affects neuronal function, particularly in the context of pain processing. Research has demonstrated that Gpr160 is required for DRG neuronal hyperexcitability induced by bone cancer pain. Neurons from Gpr160 knockout mice exhibit notably elevated action potential threshold and rheobase compared to control wild-type neurons in bone cancer pain models . Additionally, the frequency and number of action potentials in Gpr160 knockout mice were decreased relative to controls .

Conversely, overexpression of Gpr160 in cultured DRG neurons results in enhanced excitability. Gpr160-overexpressing neurons show reduced action potential threshold and rheobase, along with increased frequency and count of action potentials . These findings establish a direct link between Gpr160 expression levels and neuronal excitability, providing a mechanistic explanation for the pronociceptive effects of this receptor.

The electrophysiological changes mediated by Gpr160 have significant implications for pain processing. By modulating the excitability of nociceptive neurons, Gpr160 directly influences pain signaling pathways. The hyperexcitability induced by Gpr160 activation likely contributes to the development and maintenance of pathological pain states, including both neuropathic pain and cancer-related pain. This mechanistic understanding strengthens the rationale for targeting Gpr160 in pain management strategies.

Molecular Regulation of Gpr160 Expression

The expression of Gpr160 is regulated by multiple mechanisms, including epigenetic modifications and transcription factor activity. Research has revealed significant changes in histone modifications at the Gpr160 promoter region during bone cancer pain. Specifically, a reduction in the repressive histone mark H3K27me3 and an increase in the activating mark H3K27ac have been observed, suggesting epigenetic regulation of Gpr160 expression .

The transcription factor Sp1 has been identified as a key regulator of Gpr160 gene transcription in nociceptive DRG neurons during bone cancer pain in rodents . Elevated Sp1 levels facilitate increased Gpr160 expression, contributing to pain hypersensitivity. This finding delineates a novel mechanism wherein Sp1 works in conjunction with altered histone modifications to upregulate Gpr160 in pathological pain states.

Understanding these regulatory mechanisms provides potential alternative approaches for therapeutic intervention. Rather than targeting Gpr160 directly, modulating the upstream factors controlling its expression could offer effective strategies for pain management. Epigenetic modifiers targeting histone modifications or inhibitors of Sp1 activity could potentially normalize Gpr160 expression and alleviate pain hypersensitivity.

Experimental Applications of Recombinant Mouse Gpr160

Recombinant mouse Gpr160 has diverse applications in experimental research, enabling investigations that would be challenging with the native receptor due to expression levels or technical limitations. These applications span from basic research to drug discovery efforts.

Ligand binding studies represent a primary application for recombinant Gpr160. Purified recombinant receptor can be used in binding assays to identify and characterize interactions with potential ligands, including both natural molecules like CARTp and synthetic compounds. These studies are crucial for understanding receptor pharmacology and developing potential therapeutic agents.

Structural investigations benefit significantly from recombinant Gpr160 production. While the search results do not indicate that crystal structures have been determined for Gpr160, computational models have been developed to predict its structure . Recombinant protein production is typically a prerequisite for experimental structure determination using techniques such as X-ray crystallography or cryo-electron microscopy.

Overexpression studies using Gpr160 constructs provide valuable insights into receptor function in cellular contexts. The availability of expression plasmids, such as the tGFP-tagged mouse Gpr160 construct, enables researchers to introduce the receptor into various cell types and observe resulting changes in cellular function and signaling . Such studies have demonstrated that Gpr160 overexpression enhances neuronal excitability and promotes pain hypersensitivity .

Antibody development and validation represent another important application for recombinant Gpr160. Purified recombinant proteins serve as antigens for generating specific antibodies, which are essential tools for detecting and studying the receptor in tissues and cells. Commercial antibodies against human GPR160 are available and have been validated for applications including Western blotting, immunohistochemistry, immunofluorescence, and ELISA .

Therapeutic Potential of Gpr160 Targeting

The findings from Gpr160 knockout studies highlight this receptor's significant potential as a therapeutic target for pain management. The selective involvement of Gpr160 in pathological pain states, rather than normal nociception, suggests that targeting this receptor could provide effective pain relief with minimal disruption of normal sensory function.

The most compelling evidence for Gpr160's therapeutic potential comes from neuropathic pain models. Gpr160 knockout mice fail to develop behavioral hypersensitivities in a model of neuropathic pain caused by constriction of the sciatic nerve, while maintaining normal responses in acute pain assays . This selective effect on pathological pain makes Gpr160 an attractive target for developing novel analgesics with potentially improved side effect profiles compared to current options.

Similarly, in bone cancer pain models, global knockout of Gpr160 mitigates pain without altering normal nociceptive thresholds . These findings suggest that antagonists of Gpr160 might effectively alleviate cancer-related pain, which often responds poorly to conventional analgesics. The identification of CARTp as a ligand for Gpr160 provides additional avenues for therapeutic development, as targeting the CARTp-Gpr160 interaction could offer another approach to modulating this signaling pathway.

The results from these studies collectively support the pronociceptive roles of CARTp/GPR160 and establish GPR160 as a potential therapeutic target for the treatment of neuropathic pain . As neuropathic pain represents a significant clinical challenge with limited effective treatment options, the development of Gpr160-targeting therapeutics could address an important unmet medical need.

Future Directions in Gpr160 Research

Research on Gpr160 continues to evolve, with several promising directions for future investigation. Development of selective Gpr160 antagonists represents a particularly promising approach. Given the selective involvement of Gpr160 in pathological rather than physiological pain, antagonists could potentially provide effective pain relief with minimal side effects. The results from knockout studies support this approach, as Gpr160 knockout mice maintain normal responses to acute pain stimuli while showing resistance to pathological pain development .

Deeper characterization of the interaction between CARTp and Gpr160 is another important area for future research. While CARTp has been identified as a ligand for Gpr160, the detailed molecular mechanisms of this interaction and downstream signaling consequences remain to be fully elucidated. Understanding these details could facilitate the development of more selective and effective therapeutic agents.

Exploring the potential involvement of Gpr160 in additional physiological and pathological processes also warrants investigation. While current research has focused primarily on pain signaling, GPCRs typically participate in multiple biological functions. Comprehensive phenotyping of Gpr160 knockout models beyond pain behaviors could reveal additional roles for this receptor.

Translational research exploring the relevance of Gpr160 to human pain conditions represents a critical future direction. While mouse models have provided valuable insights, confirming similar mechanisms in human tissues will be essential for therapeutic development. Comparative studies of human and mouse GPR160 could help determine the translational potential of findings from rodent models.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Gpr160; Probable G-protein coupled receptor 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTALSSKNCSLQYQLHQSPQLLEASCLLFLIILGKVLLNILLLRVRRGDARWTLMEYFCF SLALVDLLLLVNISILTYFRDFVVLGIRFTRYHICLLTQIISFTYGFLHYPVCSLACIDY WCNLSRASKQSSRWQKLLYFLTVILTWISVLAYVLVDPAISVSLKAHRGYVYQCPAYVST QSHWLSLSMLMVLFVAFLISWQEVVALLQAMRIASYKSKAALYFPFPLHCGYALSCREAL LPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLYFVNSFLIAAVYWFNCHKLD LRDSSLPVDPFINWKCCFVPVHRLKQVERPMSIVIC
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. These findings suggest a significant role of GPR160 in regulating the entry of BCG into macrophages by targeting the ERK signaling pathway. PMID: 27259691
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Gpr160 in nociception and pain processing?

Gpr160 has been identified as a potential therapeutic target for neuropathic pain intervention. Recent studies have deorphanized GPR160, identifying cocaine- and amphetamine-regulated transcript peptide (CARTp) as its ligand. Research utilizing Gpr160 knockout mice demonstrates that these animals fail to develop behavioral hypersensitivities in models of neuropathic pain caused by sciatic nerve constriction, while maintaining normal responses in hot-plate and tail-flick assays. This suggests a selective role in pathological pain rather than normal nociception. The pronociceptive role of the CARTp/GPR160 pathway is further supported by experiments showing that behavioral hypersensitivities following intrathecal or intraplantar CARTp injections are dependent on Gpr160 expression .

Where is Gpr160 predominantly expressed in the mouse nervous system?

Immunohistochemical studies have revealed widespread distribution of Gpr160 immunoreactivity throughout the rodent brain, particularly in regions associated with pain processing, ingestive behaviors, and reward pathways. Expression has been documented throughout the rostrocaudal extent of the nucleus tractus solitarius (NTS), with dense staining lateral to the area postrema (AP). Other regions showing significant Gpr160 immunoreactivity include the parabrachial nucleus, hypoglossal nucleus, arcuate nucleus (ARC), paraventricular nucleus (PVN), nucleus accumbens shell, substantia nigra, amygdala, and specific cell layers of the hippocampus . Importantly, Gpr160 immunoreactivity has been observed in both neuronal and non-neuronal cell types, suggesting diverse functional roles .

How does Gpr160 function differ between normal and pathological states?

Electrophysiological studies demonstrate that Gpr160 function changes significantly under pathological conditions. In spinal nerve ligation (SNL) models, intrathecal GPR160 antibody administration produces modality-selective inhibitory effects similar to pregabalin. These effects are only observed in SNL rats and not in sham controls, indicating a state-dependent role. Specifically, GPR160 inhibition reduces neuronal responses to punctate mechanical stimuli in SNL rats while having no effect on heat, innocuous cooling, noxious cooling, or brush stimulation responses . The selective involvement in pathological pain states makes Gpr160 particularly interesting as a therapeutic target with potentially fewer side effects than conventional analgesics.

What methodological approaches are most effective for studying Gpr160 knockout phenotypes?

CRISPR-Cas9 genome editing technology has been successfully employed to generate global Gpr160 knockout (KO) mice. These mice are reported to be healthy and fertile with no observable physical abnormalities, making them valuable models for investigating Gpr160 function . When designing knockout studies, researchers should consider:

  • Behavioral testing batteries that include both neuropathic pain models (sciatic nerve constriction) and acute nociception assays (hot-plate, tail-flick)

  • Assessment of affective behaviors (anxiety, depression, cognition), as CARTp is known to influence these domains

  • Comparison with pharmacological approaches using passive immunoneutralization of Gpr160

  • Examination of both evoked and spontaneous pain behaviors

  • Electrophysiological recordings to assess changes in neuronal processing within pain pathways

The lack of observed differences in learning, memory, and anxiety between Gpr160 KO mice and control floxed mice suggests focused assessments of nociceptive phenotypes may be most productive .

What is the relationship between Gpr160 signaling and metabolic regulation?

Passive immunoneutralization studies targeting Gpr160 in the fourth cerebroventricle (4V) have demonstrated that this receptor is required for CARTp's anorexigenic and antidipsogenic actions. Blockade of Gpr160 in the 4V prevents CARTp-induced inhibition of food and water intake. Moreover, independent of exogenous CARTp administration, Gpr160 blockade causes increased overnight food and water intake, indicating a role for endogenous CARTp/Gpr160 signaling in baseline regulation of ingestive behaviors .

The mechanism appears to involve interaction with other metabolic signaling pathways, as the anorexigenic effect of CARTp (but not its effect on water intake) is interrupted by prior administration of a glucagon-like peptide 1 (GLP-1) receptor antagonist. This suggests differential downstream signaling pathways for food versus water intake regulation . The expression of Gpr160 in brain regions known to regulate feeding behavior (ARC, PVN, NTS) provides anatomical support for these functional findings.

How does Gpr160 expression correlate with cancer progression and metastasis?

In prostate cancer studies, GPR160 expression at both mRNA and protein levels has been associated with clinical parameters. Positive GPR160 RNA transcription correlates with higher Gleason grading scores (P = 0.026), later stage prostate cancer (P = 0.045), and elevated PSA levels (P = 0.048) . GPR160 protein expression has been linked to metastatic status using the TNM classification system (P = 0.041).

Interestingly, in vitro studies suggest that GPR160 may function as a metastasis suppressor. Increased GPR160 expression in prostate epithelial (RWPE-1) and stromal (WPMY-1) cell lines was associated with elevated epithelial markers (E-cadherin, ZO-1) and decreased mesenchymal markers (N-cadherin, vimentin, snail). Conversely, GPR160 silencing in prostate cancer cells (22Rv1) resulted in decreased epithelial markers and increased mesenchymal markers, suggesting acquisition of invasive and metastatic properties . These findings were supported by migration, invasion, and wound healing assays showing increased cell motility after GPR160 silencing in cancer cells and decreased motility after GPR160 overexpression in non-cancer cells.

What are the optimal methods for detecting and quantifying Gpr160 expression in tissue samples?

Based on the literature, multiple complementary approaches have been successfully employed:

  • In situ hybridization: RNAscope® has been used to assess Gpr160 mRNA levels in prostate samples with high sensitivity, achieving positive detection in 77.4% (154/199) of samples examined .

  • Immunohistochemistry: Using validated antibodies (such as Abcam Pa5-33650), immunohistochemistry has successfully detected Gpr160 protein expression in 65.8% (104/158) of prostate samples .

  • Western blot: This technique has been employed to analyze GPR160 expression in cell lines and to examine associations with other protein markers .

When implementing these methods, careful attention should be paid to antibody validation, as demonstrated in previous studies. The discrepancy between mRNA and protein detection rates (77.4% vs. 65.8%) highlights the importance of using multiple detection methods for comprehensive characterization.

What experimental controls are essential when studying Gpr160 function in pain models?

Critical controls for Gpr160 functional studies include:

  • Genetic controls: Comparison of Gpr160 knockout mice with age-matched and sex-matched control floxed mice .

  • Antibody controls: Use of control antibodies (IgG) in naïve animals to control for non-specific effects of antibody administration .

  • Sham procedure controls: Comparison of nerve injury models (e.g., SNL) with sham-operated animals to distinguish between injury-specific and non-specific effects .

  • Modality controls: Assessment of multiple sensory modalities (mechanical, thermal, chemical) to determine specificity of Gpr160 involvement .

  • Pharmacological controls: Comparison with established analgesics (e.g., pregabalin) to benchmark efficacy and selectivity of Gpr160-targeted interventions .

These controls help distinguish direct effects of Gpr160 manipulation from indirect or non-specific effects and establish the physiological relevance of observed changes.

How should researchers approach Gpr160 as a potential therapeutic target for neuropathic pain?

Development of Gpr160-targeted therapeutics for neuropathic pain should consider:

  • Target validation: The evidence that Gpr160 knockout mice fail to develop neuropathic pain hypersensitivity provides strong validation for this approach .

  • Mechanistic understanding: The identification of CARTp as a ligand for Gpr160 enables development of specific antagonists or biologics that disrupt this interaction .

  • Delivery considerations: Studies have demonstrated efficacy with both intrathecal and systemic administration of Gpr160-targeting antibodies, suggesting multiple potential routes of administration .

  • Selectivity assessment: Evaluate effects on normal nociception (absent in knockout studies) versus pathological hypersensitivity to develop therapeutics with minimal impact on normal pain perception .

  • Functional outcomes: Consider both sensory-discriminative aspects (mechanical hypersensitivity) and affective components of pain, given Gpr160 expression in brain regions associated with both domains .

The selective effect of Gpr160 inhibition on mechanical hypersensitivity in neuropathic states, without affecting normal nociception or responses to other sensory modalities, suggests potential for developing pain therapeutics with improved side effect profiles compared to current options.

How should researchers interpret changes in Gpr160 expression across different disease models?

When analyzing Gpr160 expression changes, consider:

  • Tissue specificity: Expression patterns differ between tissues and may have different functional implications. For example, upregulation in prostate cancer tissues correlates with disease progression , while expression in neural tissues relates to pain and feeding behaviors .

  • Cellular localization: Gpr160 is expressed in both neuronal and non-neuronal cell types, requiring careful consideration of cell type-specific effects .

  • Species differences: While many mechanisms are conserved, species-specific differences in expression or function may exist between mouse models and human disease.

  • Functional context: Expression changes should be interpreted in conjunction with functional data. For example, in prostate cancer, GPR160 expression correlates with clinical parameters despite appearing to suppress metastatic behavior in vitro .

  • Pathway integration: Consider Gpr160 signaling in the context of broader pathways, as demonstrated by the interaction with GLP-1 signaling in feeding regulation .

What statistical approaches are most appropriate for analyzing Gpr160-related behavioral data?

Based on the literature, appropriate statistical methods include:

  • For comparing genotypes or treatment groups in behavioral studies: unpaired t-tests or ANOVA with appropriate post-hoc tests .

  • For correlating Gpr160 expression with clinical parameters: Fisher's exact test or Chi-square test for categorical variables (e.g., Gleason score), and unpaired t-tests for continuous variables (e.g., PSA levels) .

  • For electrophysiological data: paired statistical tests comparing pre- and post-treatment neuronal responses within the same recording sessions .

  • For expression analyses: consideration of both mRNA and protein levels, with appropriate controls for technical variability .

  • For temporal data (e.g., feeding over time): repeated measures ANOVA or area under the curve analyses to capture both magnitude and duration of effects .

How can researchers distinguish direct from indirect effects of Gpr160 manipulation?

To differentiate direct from indirect effects:

  • Acute vs. chronic interventions: Compare short-term pharmacological inhibition (e.g., antibody neutralization) with long-term genetic deletion (knockout models) to identify compensatory mechanisms .

  • Site-specific administration: Use targeted delivery (e.g., intrathecal, intraplantar, or brain region-specific) to isolate effects to specific anatomical sites .

  • Temporal analysis: Examine immediate versus delayed responses to manipulations, with direct effects typically manifesting more rapidly.

  • Pathway dissection: Use antagonists of potential downstream pathways (as demonstrated with GLP-1 receptor antagonists) to identify separable functions .

  • Cellular resolution studies: Employ techniques that provide cellular resolution (e.g., electrophysiology, calcium imaging) to observe direct cellular responses to Gpr160 manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.