Recombinant Mouse Probable G-protein coupled receptor 171 (Gpr171)

Shipped with Ice Packs
In Stock

Description

Structure and Production

Gpr171 is a 36.7 kDa protein with seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminal tail . The recombinant variant is produced in HEK293T cells, purified to >80% purity via SDS-PAGE and Coomassie blue staining, and stored at -80°C in a Tris.HCl buffer with 10% glycerol .

ParameterValue
Molecular Mass36.7 kDa
Purity>80% (SDS-PAGE, Coomassie staining)
Concentration>50 μg/mL (BCA method)
Storage Conditions-80°C, avoid freeze-thaw cycles
TagC-terminal Myc/DDK

Functional Role and Ligand Binding

Gpr171 is activated by BigLEN, a peptide derived from proSAAS . The C-terminal tetrapeptide (Leu-Leu-Pro-Pro) of BigLEN is essential for binding and signaling . Key functional insights include:

  • Metabolic Regulation: Gpr171 knockdown in mice reduces BigLEN signaling, increasing food intake and metabolic activity during early night phases .

  • Cancer Progression: Overexpression in lung cancer promotes proliferation and metastasis, while antibody-mediated inhibition enhances EGFR inhibitor efficacy .

  • Pain Modulation: Gpr171 agonists (e.g., MS15203) reduce neuropathic and inflammatory pain in mice, potentially enhancing opioid analgesia .

  • Immune Modulation: Gpr171 suppresses T-cell activation, and its blockade increases antigen-specific T-cell responses in tumor models .

Metabolic and Feeding Studies

ApplicationFindings
Hypothalamic Gpr171 KnockdownIncreased food intake and RER in mice, altered metabolic activity
BigLEN NeutralizationSynergistic reduction in feeding when combined with Gpr171 shRNA

Oncology

ApplicationFindings
Gpr171 Antibody TreatmentReduced tumor growth in xenograft models, enhanced EGFR inhibitor efficacy
Gpr171 OverexpressionElevated proliferation and metastasis in lung cancer cells

Pain and Analgesia

ApplicationFindings
MS15203 (Agonist)Reduced chronic neuropathic pain in male mice, gender-specific effects
Gpr171 AntagonistsPotential to enhance opioid-mediated analgesia without reward liability

Gene and Protein Information

ParameterValue
Gene NameGpr171
SynonymsH963, F730001G15Rik
Gene ID229323 (Mouse)
mRNA RefSeqNM_173398
Protein RefSeqNP_775574
UniProt IDQ8BG55

Pathways and Interactions

Gpr171 participates in GPCR signaling pathways, particularly those involving purinergic nucleotides and class A rhodopsin-like receptors . Key interacting proteins include:

  • P2Y Receptors: Structural similarity but distinct ligand specificity .

  • BigLEN: Endogenous ligand critical for hypothalamic signaling .

  • EGFR: Synergistic inhibition in cancer models .

Cross-Species Availability

Recombinant Gpr171 proteins are available for multiple species, enabling comparative studies:

SpeciesSourceTag
MouseHEK293TMyc/DDK
HumanHEK293His, Avi, Fc
BovineE. coliHis
Rhesus MacaqueHEK293His (Fc)-Avi

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on your location and purchase method. For precise delivery estimates, please contact your local distributor.
Standard shipping for all our proteins includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes a 50% final glycerol concentration. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr171; Probable G-protein coupled receptor 171
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTNSSTFCPVYRDLEPFTYFFYLVFLIGIIGSCFATWAFIQKTTNHRCVSIYLINLLTAD FLLTLALPVKIIVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLIHSC KIYRIQEPGFAKMISAVVWLMVLLIMVPNMVIPIKDIKEKSNVGCMEFKKEFGRNWHLLT NFICVAIFLNFSVIILISNFLAIRQLYRNRDNTNYPSVKSALLHILLVTASYIICFVPYH AVRIPYTLSQTEVISDCSTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTETF ASPKKSKPLEERLRSENDV
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. GPR171, a hypothalamic G protein-coupled receptor, is known to bind BigLEN, a neuropeptide involved in regulating feeding behavior. PMID: 24043826
  2. Research findings indicate that the orphan receptor Gpr171 negatively regulates myeloid differentiation. PMID: 23022127
Database Links

KEGG: mmu:229323

UniGene: Mm.123648

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR171 and what is its significance in neurobiological research?

GPR171 is a G protein-coupled receptor that has been relatively recently deorphanized. It is highly expressed throughout the pain modulating regions of the brain, particularly in the ventrolateral periaqueductal gray, a structure essential for pain modulation and opioid action . The receptor's significance lies in its potential as a novel target for pain therapeutics, especially in combination with traditional opioid treatments. Research has demonstrated that activating GPR171 enhances morphine's pain-relieving properties during acute treatment in mice, suggesting its role in modulating opioid signaling pathways . Furthermore, GPR171 activation has shown promise in reducing both inflammatory and neuropathic pain in certain experimental models .

How is recombinant mouse GPR171 typically produced for research applications?

Recombinant mouse GPR171 can be produced using various expression systems, with mammalian cell-based expression being the most common for G protein-coupled receptors to ensure proper folding and post-translational modifications. For research applications, mouse GPR171 is typically expressed as a full-length protein in HEK293T cells with tags such as Myc/DDK to facilitate purification and detection . The expression construct contains the complete open reading frame (ORF) of mouse GPR171, which is 960 base pairs in length .

For functional studies in live animals or cells, GPR171 can be delivered using viral vectors. Adeno-associated viruses (AAVs) expressing mouse GPR171 under the control of promoters such as CMV are commonly used for overexpression studies . These viral delivery systems allow researchers to investigate the effects of GPR171 in specific brain regions or cell types by selecting appropriate serotypes and promoters.

What experimental models are most appropriate for studying GPR171 function?

When investigating GPR171 function, researchers have successfully employed several experimental models:

Experimental ModelApplicationKey Findings
Thermal pain testsAssessing analgesic effectsGPR171 activation reduces morphine-induced tolerance in female mice
Inflammatory pain modelsTesting anti-inflammatory effectsMS15203 (GPR171 agonist) reduces inflammatory pain in male mice
Neuropathic pain modelsEvaluating efficacy against chronic painEffective in paclitaxel-induced and chronic constriction injury models
Conditioned place preference (CPP)Assessing reward/addiction potentialUsed to determine if GPR171 activation affects morphine reward

The choice of model depends on the specific research question. For investigating pain modulation, thermal, inflammatory, and neuropathic pain models provide valuable insights. For addiction potential studies, behavioral assays like CPP are more appropriate .

How does the GPR171 agonist MS15203 modulate pain signaling pathways?

MS15203 is a small-molecule ligand for GPR171 that has demonstrated significant effects on pain signaling pathways. When administered, MS15203 activates GPR171 receptors, particularly in the ventrolateral periaqueductal gray region, enhancing morphine-mediated antinociception . The mechanism appears to involve modulation of descending pain pathways that originate in the periaqueductal gray and project to the spinal cord.

Research has shown that MS15203 is effective in:

  • Enhancing acute morphine analgesia, potentially allowing for lower doses of opioids to achieve the same pain relief

  • Attenuating nociceptor-mediated acute pain

  • Reducing inflammatory pain

  • Alleviating chronic constriction injury neuropathic pain

These effects appear to be mediated through GPR171's influence on neural circuits involved in pain processing, though the precise intracellular signaling cascades are still being characterized. Interestingly, MS15203's effects on inflammatory and paclitaxel-induced neuropathic pain show sexual dimorphism, with efficacy observed in male but not female mice, suggesting sex-specific mechanisms in GPR171 signaling related to certain pain modalities .

What are the sex differences in GPR171-mediated effects on pain and opioid responses?

Research on GPR171 has revealed intriguing sex differences in its effects on pain modulation and opioid responses:

ParameterMalesFemalesReference
Morphine tolerance reductionNo significant effectSignificant reduction in tolerance development
Inflammatory pain reductionEffectiveLess effective
Paclitaxel-induced neuropathic painEffectiveLess effective

This sexual dimorphism suggests different mechanisms or expression patterns of GPR171 between males and females. Particularly noteworthy is that activating GPR171 reduces morphine-induced tolerance specifically in female mice on thermal pain tests, while showing limited effects in males . Conversely, MS15203 is more effective in reducing inflammatory and neuropathic pain in male mice compared to females .

These findings highlight the importance of including both sexes in pain research and suggest that GPR171-targeted therapies might have sex-specific applications. The molecular basis for these differences remains to be fully elucidated but may involve interactions with sex hormones or sex-specific differences in receptor expression or signaling.

How can researchers effectively quantify GPR171 expression in brain tissue?

Accurate quantification of GPR171 expression in brain tissue is essential for understanding its role in pain modulation and opioid responses. Several complementary methods can be employed:

  • Immunohistochemistry/Immunofluorescence:

    • Enables visualization of GPR171 distribution in specific brain regions

    • Can be combined with markers for cell types to determine cellular localization

    • Particularly useful for examining expression in pain-modulating regions like the ventrolateral periaqueductal gray

  • Western Blotting:

    • Provides semi-quantitative measure of total GPR171 protein

    • Useful for comparing expression levels between different experimental conditions

  • qRT-PCR:

    • Quantifies GPR171 mRNA expression

    • Enables detection of transcriptional changes in response to treatments

  • RNAscope or In Situ Hybridization:

    • Allows visualization of mRNA expression with cellular resolution

    • Can be combined with immunohistochemistry for co-localization studies

For mapping GPR171 throughout reward structures of the brain (hippocampus, basolateral amygdala, nucleus accumbens, prefrontal cortex, and ventral tegmental area), researchers have successfully employed a combination of these techniques .

What mechanisms underlie GPR171's ability to reduce morphine tolerance and what are the implications for developing improved pain therapeutics?

The ability of GPR171 activation to reduce morphine tolerance, particularly in female mice, represents a significant finding with therapeutic potential. The underlying mechanisms appear to involve multiple pathways:

  • Modulation of μ-opioid receptor signaling: GPR171 activation may influence the desensitization, internalization, or recycling of μ-opioid receptors, thereby maintaining their responsiveness to morphine during repeated exposure.

  • Alteration of downstream signaling pathways: GPR171 likely modifies the intracellular signaling cascades activated by morphine, potentially reducing adaptive changes that lead to tolerance.

  • Neuronal circuit modulation: Given GPR171's expression in the ventrolateral periaqueductal gray, activation may regulate the activity of descending pain control pathways that mediate morphine's analgesic effects.

The sex-specific effects observed in morphine tolerance studies suggest that female-specific mechanisms may be involved, possibly related to interactions with estrogen signaling or sex-specific differences in receptor distribution .

These findings have important implications for developing improved pain therapeutics:

  • Combination therapies using GPR171 agonists with lower doses of opioids could potentially reduce tolerance development while maintaining analgesic efficacy

  • Sex-specific treatment approaches may be warranted, with GPR171-targeted therapies potentially offering particular benefits for female patients

  • The reduced tolerance profile suggests potential for decreased risk of dose escalation and subsequent dependence, addressing key challenges in chronic pain management

How does GPR171 interact with the endogenous ProSAAS-derived neuropeptide system?

GPR171 has been identified as the receptor for the neuropeptide BigLEN, which is derived from the precursor protein ProSAAS. This interaction represents an important signaling system in the regulation of pain and potentially reward processing:

  • Distribution patterns: Both ProSAAS and GPR171 exhibit overlapping distribution in key brain regions involved in pain processing and reward, including the ventrolateral periaqueductal gray, hippocampus, basolateral amygdala, nucleus accumbens, prefrontal cortex, and ventral tegmental area .

  • Signaling mechanisms: The endogenous BigLEN-GPR171 signaling system likely involves Gi/o protein coupling, leading to inhibition of adenylyl cyclase and modulation of downstream effectors.

  • Functional consequences: Activation of the ProSAAS-BigLEN-GPR171 signaling axis appears to modulate:

    • Pain sensitivity

    • Responses to inflammatory and neuropathic pain stimuli

    • Opioid analgesia and tolerance development

Research suggests that mapping the distribution of both ProSAAS and GPR171 throughout reward structures of the brain provides insights into the potential role of this signaling system in both pain control and reward processing . Understanding this interaction is crucial for developing targeted therapies that modulate the endogenous system rather than relying solely on exogenous agonists.

What are the most effective experimental approaches for investigating GPR171's role in opioid reward pathways?

Investigating GPR171's role in opioid reward pathways requires sophisticated experimental approaches that can distinguish between analgesic effects and reward/addiction potential. Several complementary methods have proven effective:

  • Conditioned Place Preference (CPP):

    • This behavioral paradigm assesses the rewarding or aversive properties of drugs

    • The experimental setup involves two distinct chambers with different visual and tactile cues

    • Animals receive drug in one chamber and vehicle in the other across multiple conditioning sessions

    • On test day, time spent in each chamber is measured to assess preference

    • Research has used this approach to evaluate whether GPR171 agonists like MS15203 produce reward on their own or modify morphine-induced reward

  • Neuronal Activation Studies:

    • Examining activation of ventral tegmental area (VTA) dopamine neurons following GPR171 agonist administration

    • Using immediate early gene expression (e.g., c-Fos) as markers of neuronal activation

    • Comparing patterns of activation between GPR171 agonist alone and in combination with morphine

  • Anatomical Mapping:

    • Detailed mapping of GPR171 expression in reward-related brain regions (hippocampus, basolateral amygdala, nucleus accumbens, prefrontal cortex, and ventral tegmental area)

    • Correlating expression patterns with functional outcomes in behavioral studies

  • Genetic Approaches:

    • Using viral vectors for overexpression or knockdown of GPR171 in specific brain regions

    • AAV-mediated gene delivery allows region-specific manipulation of GPR171 expression

    • Available tools include AAV expressing mouse GPR171 under various promoters

These approaches collectively provide a comprehensive assessment of GPR171's role in reward processing and its potential impact on opioid reward and addiction potential.

What are the optimal protocols for expressing and purifying recombinant mouse GPR171 for structural and functional studies?

For successful expression and purification of recombinant mouse GPR171, researchers should consider the following optimized protocols:

  • Expression Systems:

    • Mammalian expression systems (particularly HEK293T cells) are preferred for maintaining proper folding and post-translational modifications of GPR171

    • Expression constructs should contain the full-length mouse GPR171 ORF (960 bp)

    • C-terminal tags such as Myc/DDK facilitate purification and detection without interfering with receptor function

  • Purification Strategy:

    • Two-step affinity purification using anti-DDK antibody columns followed by size exclusion chromatography

    • Careful selection of detergents is critical for maintaining receptor stability and function

    • Mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) are often suitable

  • Quality Control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify folding integrity through ligand binding assays

    • Thermal stability assays can provide insights into protein quality

For functional studies using cell-based systems, transfection efficiency and expression levels should be monitored using fluorescent tags or antibody detection methods. When using viral vectors for in vivo studies, careful consideration of serotype selection based on target tissue tropism is essential .

How should researchers design experiments to account for the sex differences observed in GPR171-mediated effects?

Given the documented sex differences in GPR171-mediated effects, researchers should implement the following experimental design considerations:

  • Include Both Sexes:

    • Studies should include both male and female animals in sufficient numbers to detect sex-specific effects

    • Power analyses should account for potential variability within each sex group

  • Hormonal Considerations:

    • Track estrous cycle stages in female animals

    • Consider potential interactions between sex hormones and GPR171 signaling

    • Include ovariectomized females with and without hormone replacement as additional controls when investigating mechanisms

  • Statistical Analysis:

    • Pre-plan statistical approaches for assessing sex as a biological variable

    • Use appropriate statistical tests that can detect sex by treatment interactions

    • Avoid pooling data from both sexes if sex differences are observed

  • Mechanistic Investigations:

    • When sex differences are identified (e.g., GPR171 activation reducing morphine tolerance in females but not males ), conduct follow-up studies to determine underlying mechanisms

    • Investigate potential differences in receptor expression, distribution, or signaling between sexes

  • Reporting:

    • Clearly report sex-disaggregated data

    • Discuss implications of any sex differences observed

These considerations are particularly important given that GPR171 activation reduces morphine tolerance specifically in female mice on thermal pain tests , while MS15203 is more effective against inflammatory and neuropathic pain in males .

What are the most reliable methods for assessing GPR171 activation in in vitro and in vivo systems?

Reliable assessment of GPR171 activation requires complementary approaches in both in vitro and in vivo systems:

In Vitro Methods:

  • G Protein Coupling Assays:

    • BRET/FRET-based assays to measure G protein activation

    • [35S]GTPγS binding assays to quantify G protein activation

    • Measurement of downstream signaling (cAMP levels, Ca2+ mobilization)

  • β-Arrestin Recruitment:

    • BRET/FRET-based assays to monitor β-arrestin recruitment following receptor activation

    • PathHunter or TANGO assays for high-throughput screening

  • Receptor Internalization:

    • Fluorescently tagged GPR171 to track subcellular localization changes upon agonist treatment

    • Flow cytometry to quantify surface expression changes

In Vivo Methods:

  • Behavioral Assays:

    • Thermal pain tests (tail flick, hot plate) to assess analgesic effects

    • Von Frey filament testing for mechanical sensitivity

    • Conditioned place preference for reward-related effects

  • Electrophysiology:

    • In vivo recordings from ventrolateral periaqueductal gray neurons

    • Ex vivo slice recordings following in vivo treatments

  • Molecular Markers:

    • Phospho-ERK or phospho-CREB immunostaining to detect activated signaling pathways

    • c-Fos expression as a marker of neuronal activation

    • Monitoring changes in downstream gene expression

  • PET Imaging:

    • Development of radiolabeled GPR171 ligands for PET imaging

    • Monitoring receptor occupancy in vivo

For comprehensive assessment, researchers should employ multiple complementary methods, as each provides different information about receptor activation and functional consequences.

What are the most promising approaches for developing selective GPR171 ligands with improved therapeutic profiles?

Developing selective GPR171 ligands with improved therapeutic profiles represents a significant opportunity in pain research. Several promising approaches include:

  • Structure-Based Drug Design:

    • Determining the crystal structure of GPR171 in complex with existing ligands

    • Using computational modeling to identify binding pockets and design selective compounds

    • Virtual screening of compound libraries based on structural insights

  • Medicinal Chemistry Optimization of MS15203:

    • The existing GPR171 agonist MS15203 provides a starting point for structural modifications

    • Structure-activity relationship studies to enhance potency, selectivity, and bioavailability

    • Development of derivatives with improved blood-brain barrier penetration

  • Allosteric Modulator Development:

    • Identifying positive allosteric modulators that enhance endogenous BigLEN signaling

    • Allosteric modulators may offer improved selectivity and reduced side effects compared to orthosteric agonists

  • Biased Ligand Development:

    • Creating ligands that selectively activate beneficial signaling pathways while minimizing those associated with side effects

    • Biased agonists might selectively enhance analgesic effects without affecting reward pathways

  • Peptide-Based Approaches:

    • Developing modified versions of the endogenous ligand BigLEN with enhanced stability and bioavailability

    • Peptide-small molecule hybrids to combine selectivity with drug-like properties

The goal of these approaches would be to develop compounds that maintain the beneficial effects of GPR171 activation on pain and morphine tolerance while addressing the observed sex differences and ensuring no enhancement of reward or addiction potential .

How might GPR171 targeting be incorporated into multimodal pain management strategies?

GPR171 targeting offers several promising approaches for integration into multimodal pain management strategies:

  • Opioid-Sparing Combinations:

    • Combining GPR171 agonists with lower doses of opioids could enhance analgesia while reducing opioid-related side effects

    • This approach leverages the finding that GPR171 activation enhances morphine's pain-relieving properties

    • Potentially allows for dose reduction of opioids by 30-50% while maintaining equivalent analgesia

  • Sex-Specific Treatment Strategies:

    • GPR171-targeted therapies might be particularly valuable for female patients in managing opioid tolerance

    • Different combinations might be optimal for male patients, focusing on inflammatory and neuropathic pain conditions

  • Chronic Pain Management:

    • For long-term pain management, GPR171 agonists might help prevent or delay tolerance development

    • This could address a key challenge in chronic pain treatment, where opioid efficacy often diminishes over time

  • Multimodal Non-Opioid Approaches:

    • Combining GPR171 agonists with other non-opioid analgesics (NSAIDs, anticonvulsants, antidepressants)

    • This might provide synergistic pain relief through multiple mechanisms

  • Precision Medicine Applications:

    • Genetic or biomarker screening might identify patients most likely to benefit from GPR171-targeted therapies

    • Personalized approaches based on sex, pain condition, and genetic factors

The research suggests that GPR171-targeted therapies could be particularly valuable as adjuncts to existing pain management approaches, potentially addressing some of the major limitations of current treatments, especially for chronic pain conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.