Recombinant Mouse Probable G-protein coupled receptor 174 (Gpr174)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Probable G-protein coupled receptor 174 (Gpr174) is a synthetically produced transmembrane protein belonging to the class A/rhodopsin-like G protein-coupled receptor (GPCR) family. It is primarily expressed in immune cells, such as T and B lymphocytes, and plays critical roles in modulating immune responses via Gαs-mediated signaling pathways . Recombinant Gpr174 is generated using heterologous expression systems (e.g., E. coli, mammalian cells) for functional and structural studies .

Gene and Protein Overview

  • Gene: Gpr174 (synonyms: Gm376, Lypsr3) is located on the X chromosome (Xq13.3) .

  • Protein: A 7-transmembrane receptor with 330 amino acids (UniProt: Q3U507) . Key structural features include:

    • A lysophosphatidylserine (lysoPS)-binding pocket in the orthosteric site .

    • Non-canonical Gαs coupling involving TM1, TM2, and TM7 helices .

    • Greater than 85% purity when produced recombinantly .

Immune Regulation

  • T Cells:

    • Gpr174 suppresses regulatory T cell (Treg) accumulation and IL-2 production .

    • Deficiency reduces proinflammatory cytokines (e.g., TNF-α, IL-1β) and improves survival in septic mice .

  • B Cells:

    • Mediates Gαs-dependent upregulation of CD86 and CCR7, influencing B cell activation and marginal zone (MZ) B cell maintenance .

Disease Associations

ConditionRole of Gpr174Study Model
SepsisLower Gpr174 mRNA correlates with severity and mortality; KO mice show reduced organ damageCLP-induced mice
AutoimmunityVariants linked to Graves’ disease and lupus; modulates Treg functionHuman GWAS
Inflammatory ResponseLysoPS-GPR174 signaling exacerbates cytokine storms via IL-10/IL-1β modulationLPS-challenged mice

Production Systems

  • Hosts: E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: ≥85% (SDS-PAGE) .

  • Applications:

    • Western blot, ELISA, immunohistochemistry .

    • Functional assays (e.g., cAMP measurement) .

Mechanistic Insights from Recent Studies

  • LysoPS Binding:

    • LysoPS binds Gpr174 with high specificity via charge complementarity, inducing maximal receptor activation .

    • Mutants with reduced lysoPS affinity show dose-dependent responses to exogenous lysoPS .

  • Signaling Pathways:

    • Canonical: Gαs-cAMP-PKA axis upregulates Nr4a1 and Cd86 .

    • Non-canonical: Gα12/13 coupling observed in certain immune contexts .

Clinical and Therapeutic Implications

  • Biomarker Potential:

    • Serum GPR174 mRNA levels predict sepsis mortality (AUC = 0.83) .

  • Therapeutic Targets:

    • Antagonists may mitigate cytokine storms or enhance B cell survival in culture .

    • Agonists could modulate Treg activity in autoimmune diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Gpr174; Gm376; Probable G-protein coupled receptor 174
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTDNFTCNKTDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVVFMIN LAIADLLQILSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL MYPFRFNDCKQKYDLYISIIGWLIICLACLLFPLLRTNDDTPGNRTKCFVDLPIRNVNLA QSVAMITIGEVVGFVTPLMIVLYCTWKTALSLQNKYPISQHLGEKKKALKMILTCAGVFL VCFVPYHFSFPLDFLVKSNEIKSCFARRVILIFHSVALCLASLNSCLDPVIYYFTTNEFR RRLSRQDLPDNIQLHTKSYKIASNHATSTVAAELC
Uniprot No.

Target Background

Function
Putative receptor for purines coupled to G-proteins.
Gene References Into Functions
  1. The lysophosphatidylserine receptor GPR174 constrains regulatory T cell development and function. PMID: 26077720
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen and, at low levels, in brain.

Q&A

What is GPR174 and where is it primarily expressed?

GPR174 is a seven-transmembrane G protein-coupled receptor primarily expressed on immune cells, particularly T and B lymphocytes. In mouse models, high reporter expression is observed in naive T and B cells, with strong expression in spleen follicular and marginal zone B cells. Minimal expression is typically observed in CD23--CD93+ transitional B cells . GPR174 is encoded by a single coding exon and is located on the X chromosome, which is relevant for studies using heterozygous female mice where random X inactivation results in approximately 50% reporter-positive (and thus GPR174-deficient) cells .

How can I generate GPR174-knockout mice for research?

GPR174-knockout mice can be generated using homologous recombination methods as demonstrated in multiple studies. A common approach involves replacing the single coding exon of Gpr174 with an in-frame reporter gene such as tdTomato, which allows visual confirmation of knockout and tracking of cells that would normally express GPR174 . For tracking GPR174 expression patterns, researchers have utilized Gpr174+/- female mice, in which random X inactivation yields approximately 50% reporter-positive cells, creating an internal control system .

Alternative approaches utilize CRISPR-Cas9 technology to generate targeted deletions in the Gpr174 gene. When designing knockout strategies, consider including reporter constructs to facilitate identification of cells that would normally express GPR174, as this aids in downstream analysis.

What are the optimal methods for measuring GPR174 mRNA expression?

For quantitative analysis of GPR174 mRNA expression, quantitative PCR (qPCR) is the most commonly employed method. The protocol involves:

  • Isolating peripheral blood mononuclear cells (PBMC) from fresh anticoagulant blood using Ficoll lymphocyte separation solution

  • Extracting total RNA using TRIzol reagent

  • Reverse-transcribing 10 μg of RNA samples into cDNA with appropriate reagent kits

  • Performing qPCR with SYBR-based systems on standard real-time PCR equipment

For mouse Gpr174, researchers have successfully used the following primers:

  • mouse-Gpr174 sense: 5'-TTGGTCTGCATCAGTGTGCGAAG

  • mouse-Gpr174 antisense: 5'-CAGGCAGGCAAGGCAGATGATC

For human GPR174:

  • human-GPR174 sense: 5'-ATCATCTGCCTTGCCTGTGTACTC

  • human-GPR174 antisense: 5'-CGCCAATGGTCATCATAACAACGG

For more comprehensive transcriptomic analysis, RNA sequencing can be performed following standard mRNA isolation protocols using Dynabeads® mRNA DIRECT™ Kit and library preparation with stranded mRNA-Seq kits .

How should I design experiments to assess GPR174 function in immune cells?

When designing experiments to assess GPR174 function in immune cells, consider the following approach:

  • Comparative analysis: Include both wild-type and GPR174-knockout populations. For B cell studies, isolate follicular B cells from spleens of both genotypes using standard magnetic bead-based or flow cytometry-based isolation techniques.

  • Ex vivo culture conditions: For B cell experiments, culture cells in standard medium (RPMI 1640 supplemented with 10% FCS, antibiotics, and β-mercaptoethanol). Note that even without stimulation, B cells undergo massive changes in gene expression during culture, many of which are GPR174-dependent .

  • Viability assessment: Include viability measurements at 24-48 hour intervals, as GPR174 and Gαs also contribute to reduced B cell viability during culture .

  • Gene expression analysis: Plan for RNA sequencing at multiple timepoints (e.g., 4 hours, 24 hours) to capture the dynamic changes in gene expression profiles. Key genes to monitor include Cd86, Nr4a1, Ccr7, and various phosphodiesterases .

  • Functional assays: Include assays for specific cellular functions, such as activation marker expression (CD86), migration assays, or cytokine production in response to stimuli.

How does GPR174 deficiency impact sepsis outcomes and what are the underlying mechanisms?

GPR174 deficiency has been shown to improve outcomes in cecal ligation and puncture (CLP)-induced septic mouse models, with reduced multi-organ damage . The mechanisms underlying this protective effect involve:

  • Altered cytokine profile: GPR174-deficient mice show increased levels of anti-inflammatory IL-10 and decreased levels of pro-inflammatory cytokines IL-1β and TNF-α during sepsis .

  • Transcriptomic changes: RNA sequencing analysis reveals that GPR174 deficiency induces a phenotypic shift toward multiple immune response pathways in septic mice .

  • Survival advantage: The absence of GPR174 is associated with improved survival outcomes in sepsis models, suggesting a potentially deleterious role of normal GPR174 signaling during overwhelming infection .

This is supported by clinical data showing that septic patients with lower GPR174 mRNA expression at day 7 post-ICU admission had a significantly worse survival rate compared to those with higher expression . This apparent contradiction between mouse models and human data highlights the complex role of GPR174 in sepsis pathophysiology and suggests potential differences in acute versus sustained GPR174 deficiency.

What are the effects of GPR174 signaling on B cell gene expression and survival?

GPR174 signaling has profound effects on B cell gene expression and survival:

  • Gene expression changes: Unstimulated cultured B cells undergo changes in expression of approximately 1,000 genes after just 4 hours, with many of these changes being GPR174-dependent . Key induced genes include:

    • Cd86 (encoding costimulatory molecule CD86)

    • Nr4a1 (encoding the transcription factor NUR77)

    • Ccr7 (encoding chemokine receptor CCR7)

    • Various phosphodiesterases

  • Receptor downregulation: GPR174 signaling leads to downregulation of immunoreceptor tyrosine-based inhibitory motif (ITIM)-containing receptors .

  • Survival impact: GPR174 and Gαs deficiencies are associated with augmented B cell survival when cells are maintained in vitro for 1-2 days without stimulation .

  • Marginal zone B cell development: In vivo, GPR174 and Gαs-deficient mice exhibit a reduced marginal zone B cell compartment, suggesting a role for this receptor in B cell compartmentalization or development .

These findings indicate that GPR174 functions as a receptor capable of exerting large influences on B cell gene expression and survival, even in the absence of exogenous stimulation or BCR signaling.

What is the relationship between GPR174 expression and autoimmune diseases?

Variants in the GPR174 locus have been associated with several autoimmune diseases , suggesting that altered GPR174 expression or function may contribute to immune dysregulation. The relationship appears to involve:

  • T regulatory cell function: GPR174 has been shown to restrain T regulatory cell development and function , which are critical for preventing autoimmunity.

  • Conventional T cell responses: GPR174 also regulates conventional T cell proliferation and IL-2 production .

  • B cell activation: Through its effects on CD86 expression and other activation-associated genes, GPR174 may influence B cell contributions to autoimmunity .

  • X-chromosome location: The location of GPR174 on the X chromosome may contribute to sex biases observed in certain autoimmune conditions .

Research suggests that GPR174 antagonists may be useful therapeutic tools for modulating immune responses in autoimmune contexts by reducing shifts in gene expression and augmenting lymphocyte survival .

How can GPR174 mRNA expression be used as a prognostic biomarker in inflammatory conditions?

GPR174 mRNA expression has emerging value as a prognostic biomarker, particularly in sepsis:

  • Diagnostic potential: The relative expression of GPR174 mRNA is significantly lower in septic patients compared to non-septic ICU controls and healthy volunteers at day 1 post-ICU admission, indicating potential utility for early diagnosis .

  • Severity correlation: Decreased relative expression of serum GPR174 mRNA correlates with illness severity in sepsis, showing relationships with:

    • Lymphocyte counts (positive correlation)

    • C-reactive protein levels

    • APACHE II and SOFA clinical severity scores

  • Mortality prediction: Both logistic regression and Cox regression analyses show that GPR174 mRNA expression at day 7 post-ICU admission is an independent predictor of 90-day mortality in septic patients . The ROC analysis yields:

    • Day 7 cut-off level: 0.101

    • Sensitivity: 0.890

    • Specificity: 0.720

  • Dynamic biomarker: GPR174 mRNA shows remarkable differences between survivor and non-survivor groups when tracked longitudinally (ascending in survivors, descending in non-survivors), outperforming traditional markers including APACHE II and SOFA scores .

This evidence suggests GPR174 mRNA expression could serve as a sensitive and dynamic prognostic biomarker in inflammatory conditions, particularly sepsis.

What are the challenges in developing GPR174-targeted therapeutics?

Developing therapeutics targeting GPR174 presents several challenges:

  • Signaling pathway complexity: The uncertainty regarding which G protein pathways are engaged by GPR174 in different cell types and contexts complicates drug development. Different studies have implicated Gαs, Gαi, Gα12/13, and Gα13 in GPR174 signaling .

  • Context-dependent effects: GPR174 appears to have different, sometimes opposing effects in different disease models. While GPR174 deficiency is beneficial in mouse sepsis models , the receptor's role in autoimmunity and other inflammatory contexts may be more complex.

  • Ligand uncertainty: While lysoPS has been identified as a ligand, there are conflicting reports about other potential ligands like CCL19 and CCL21 . This ambiguity makes it difficult to develop drugs that specifically target GPR174-ligand interactions.

  • Cell type specificity: GPR174 is expressed on multiple immune cell types, including T cells and B cells, with potentially different functions in each. Targeting GPR174 systemically might yield unpredictable effects across different immune compartments.

Despite these challenges, the development of specific GPR174 antagonists may still be valuable for reducing shifts in gene expression and augmenting B cell survival during research applications and potentially as therapeutic agents .

What controls should be included when performing experiments with GPR174-deficient mice?

When designing experiments with GPR174-deficient mice, include the following controls:

  • Age and sex-matched wild-type controls: Due to the X-linked nature of GPR174, sex-matching is particularly important. For female mice, consider the effects of random X-inactivation on experimental outcomes .

  • Heterozygous females: Gpr174+/- female mice provide a unique internal control system where approximately 50% of cells are GPR174-deficient (reporter-positive) while the remaining cells have normal GPR174 expression .

  • Sham-operated controls: For disease models like CLP-induced sepsis, include sham-operated mice that undergo the same surgical procedures without the disease-inducing steps (e.g., without cecal puncture or ligation) .

  • Time-course controls: Given the dynamic changes in GPR174 expression during disease progression, include controls at multiple timepoints to capture temporal variations .

  • Positive control for GPR174 activation: When testing GPR174 function, include experiments with known ligands like lysoPS to confirm receptor responsiveness in wild-type cells .

How can I optimize the detection of GPR174 expression and signaling in mouse models?

To optimize detection of GPR174 expression and signaling:

  • Reporter systems: Use reporter gene knockin strategies (e.g., tdTomato) to visualize cells that express GPR174 .

  • Primer optimization for qPCR: Validate primers using standard curves and ensure they span exon-exon junctions where possible. For mouse Gpr174, the following primers have been validated:

    • Forward: 5'-TTGGTCTGCATCAGTGTGCGAAG

    • Reverse: 5'-CAGGCAGGCAAGGCAGATGATC

  • Downstream signaling markers: Monitor cAMP levels and PKA activity to assess Gαs signaling pathway activation. For other potential G protein pathways, measure relevant second messengers accordingly.

  • Surface protein detection: If antibodies are available, use flow cytometry to detect surface expression of GPR174.

  • Readout genes: Monitor expression of known GPR174-dependent genes like CD86 and Nr4a1 (NUR77) as functional readouts of GPR174 signaling .

  • NUR77-GFP reporter systems: Consider using NUR77-GFP reporter mouse models crossed with GPR174-deficient mice to assess the impact of GPR174 on this downstream transcription factor .

What are the key unresolved questions about GPR174 biology?

Several key questions about GPR174 biology remain unresolved:

  • Definitive signaling pathways: Resolving the contradictory reports about which G protein pathways (Gαs, Gαi, Gα12/13) are engaged by GPR174 in different cell types and contexts .

  • Comprehensive ligand identification: Confirming whether CCL19 and CCL21 are genuine ligands for GPR174 in addition to lysoPS, and identifying any other potential physiological ligands .

  • Role in different immune cell subsets: While effects on B cells and Tregs have been studied, the function of GPR174 in other immune cell populations remains less explored.

  • Mechanism of action in sepsis: Clarifying why GPR174 deficiency is protective in mouse sepsis models while decreased GPR174 mRNA correlates with worse outcomes in human sepsis patients .

  • Structure-function relationship: Determining the structural basis for GPR174 ligand binding and G protein coupling selectivity.

  • Therapeutic potential: Evaluating whether GPR174 modulation could be therapeutically beneficial in autoimmune diseases or sepsis, and developing specific agonists or antagonists.

How might single-cell technologies advance our understanding of GPR174 function?

Single-cell technologies offer several opportunities to advance GPR174 research:

  • Cell-specific expression patterns: Single-cell RNA sequencing can provide higher resolution mapping of GPR174 expression across immune cell subsets and activation states, revealing potentially important expression patterns missed by bulk analysis.

  • Heterogeneous responses: Single-cell analysis of GPR174-dependent signaling could reveal heterogeneity in responses even within seemingly homogeneous cell populations.

  • Trajectory analysis: Single-cell trajectory analysis could help determine how GPR174 influences cell fate decisions or developmental pathways, particularly in B cell and T cell lineages.

  • Spatial context: Spatial transcriptomics could reveal the importance of GPR174 expression in specific tissue microenvironments, potentially explaining context-dependent functions.

  • Protein-level analysis: Single-cell proteomics and phosphoproteomics could map GPR174-dependent signaling networks with unprecedented resolution, helping to resolve contradictory findings about downstream pathways.

  • Genetic perturbation screening: Combining CRISPR screening with single-cell readouts could identify novel genes that interact with GPR174 signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.