Recombinant Mouse Probable G-protein coupled receptor 22 (Gpr22)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse Gpr22 is produced using multiple expression systems:

Host Systems and Yields

HostAdvantagesApplications
E. coliCost-effective, high yieldStructural studies, antibody production
Mammalian Cells (HEK-293)Proper folding, post-translational modificationsFunctional assays, signaling studies
Cell-Free SynthesisRapid production, no host contaminantsHigh-throughput screening

Purification Methods

  • Affinity chromatography (His-tag/Strep-tag)

  • Protein G purification (antibody production)

Functional and Signaling Properties

Gpr22 constitutively couples to Gαi/Gαo proteins, leading to inhibition of adenylate cyclase and reduced cAMP production . Key functional findings include:

Research Findings

Study ModelKey OutcomeMechanismSource Citation
HEK-293 TransfectionConstitutive Gαi/Gαo couplingReduced cAMP, cardioprotection
Gpr22 Knockout MiceIncreased cardiac decompensation post-aortic bandingLoss of stress adaptation
Cardiomyocyte OverexpressionAmeliorated myocardial infarctionPI3K-Akt pathway activation
Zebrafish Morpholino KnockdownCilia defects, disrupted left-right asymmetryUnclear (non-PKA pathway)

Cardiac Pathophysiology

  • Pressure Overload Models: Gpr22-deficient mice exhibit worsened cardiac function after aortic banding, indicating its role in stress adaptation .

  • Ischemic Injury: Overexpression in cardiomyocytes reduces infarct size via Akt-mediated survival signaling .

Cilia Regulation

Knockdown or overexpression in zebrafish disrupts cilia structure in Kupffer’s vesicle, altering left-right patterning during embryogenesis .

Limitations and Future Directions

  • Orphan Receptor Status: The absence of a known ligand restricts mechanistic studies .

  • Species-Specific Effects: Most data derive from murine/zebrafish models; human relevance requires validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpr22; G-protein coupled receptor 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MCFSPVLEINMQSESNVTVRDDIDDIDTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNL TVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEA CVSFASVSTAINVFAITLDRYDISVKPANRILTMGRAVMLMTSIWIFSFFSFLIPFIEVN FFSLQSGNTWANKTLLCVSTSEYYTELGMYYHLLVQIPIFFFTVIVMLITYTKILQALNI RIGTRFSTGQKKKARKKKTISLATHETTDMSQSSGGRNVVFGVRTSVSVIIALRRAVKRH RERRERQKRVFKMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRLCFLVMAYGTTI FHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPMPNNAVIHNSWIDPKRNKKVTYEDSEI REKCLVPQVVTD
Uniprot No.

Target Background

Function
Orphan G-protein coupled receptor. It appears to function via a G(i)/G(o) mediated pathway and may be involved in ciliogenesis.
Gene References Into Functions
  1. Demonstrates GPR22 expression in the mouse heart and identifies a protective role for GPR22 in response to hemodynamic stress from increased afterload. PMID: 18539757
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Abundant levels detected in the brain and heart and no detectable expression in other peripheral tissues.

Q&A

How should researchers prepare cardiac tissue samples for GPR22 analysis?

Cardiac tissue homogenization must preserve GPR22’s labile structure:

  • Use ice-cold RIPA buffer with protease inhibitors (e.g., 1 mM PMSF) to avoid degradation.

  • Centrifuge at 16,000 × g for 20 min at 4°C to isolate soluble fractions .

  • Validate lysate quality via β-actin Western blotting to ensure equal loading .

ParameterRecommendationRationale
HomogenizationMechanical disruption with glass beadsPrevents GPCR denaturation
StorageAliquot at −80°C; avoid freeze-thaw cyclesStability loss <5% over 6 months

What controls are essential for GPR22 knockout studies?

When using GPR22−/− mice:

  • Confirm germline deletion via Southern blotting with XbaI digestion and 990-bp 5′/930-bp 3′ probes .

  • Include heterozygous (GPR22+/−) and wild-type littermates to assess gene dosage effects.

  • Monitor cardiac hypertrophy markers (e.g., ANP, BNP) due to GPR22’s constitutive Gi coupling in myocytes .

How can researchers resolve contradictory signaling data for GPR22 in heterologous systems?

Constitutive Gi coupling of GPR22 is detectable only under optimized expression conditions :

Problem: Weak/no signal in transiently transfected cells.
Solution:

  • Use synthetic GPR22 (sGPR22) with codon-optimized sequence (59% G/C vs. 36% in wild type) .

  • Validate mRNA stability via Northern blotting (30-min exposure post-transfection) .

  • Measure [35S]GTPγS binding in membrane fractions to confirm basal Gi activity .

Experimental Workflow:

  • Transfect COS7 cells with sGPR22 under CMV promoter.

  • Assess membrane localization via HA-tag immunocytochemistry.

  • Quantify cAMP suppression (20–30% reduction vs. vector control) with/without pertussis toxin .

What strategies mitigate false negatives in recombinant GPR22 detection?

Commercial ELISAs show limited cross-reactivity with recombinant GPR22 due to structural differences :

ApproachProtocolValidation
Epitope taggingClone HA/FLAG tags at N-terminusFlow cytometry (≥80% transfection efficiency)
Cross-validationCombine ELISA with [35S]GTPγS binding assaysConfirm functional coupling despite low protein yield

How to interpret tissue-specific mRNA/protein expression discrepancies?

GPR22 mRNA levels exceed β1-adrenergic receptor levels in human heart tissue, yet protein abundance may not correlate :

Troubleshooting Framework:

  • Technical factors:

    • Compare in situ hybridization (antisense vs. sense probes) and ELISA (spike-and-recovery assays) .

    • Rule out RNA degradation via Agilent Bioanalyzer.

  • Biological factors:

    • Assess post-transcriptional regulation (e.g., miR-328 targeting 3′UTR).

    • Profile protein half-life using cycloheximide chase assays.

What in vivo models best recapitulate GPR22’s cardiac pathophysiology?

Germline GPR22−/− mice show no overt phenotype, necessitating conditional models :

ModelUtilityLimitations
Cardiomyocyte-specific KO (αMHC-Cre)Assess contractile dysfunctionNeonatal lethality if deleted embryonically
Coronary artery endothelial KO (Tie2-Cre)Study vascular remodelingOff-target effects in bone marrow

Key Parameters:

  • Monitor echocardiographic indices (e.g., LVEF, FS) post-TAC surgery.

  • Profile Gi activity via PTX-sensitive cAMP assays in isolated myocytes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.