Recombinant Mouse Probable G-protein coupled receptor 33 (Gpr33)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Mouse Gpr33 is implicated in innate immunity, with studies highlighting its regulatory role in dendritic cells (DCs) via TLR/NF-κB/AP-1 signaling . Key functional observations include:

  • Immune Modulation: TLR3/7 agonists (e.g., poly I:C, R-848) upregulate Gpr33 expression in murine lymphoid organs in vivo .

  • Pseudogenization: Unlike humans, where GPR33 contains a premature stop codon, the mouse gene remains transcriptionally active .

  • Ligand Status: Gpr33 is classified as an orphan receptor, with no endogenous ligands identified to date .

Research Applications

Recombinant Gpr33 is widely used in biochemical and immunological studies:

ApplicationExperimental UseSource
Protein InteractionScreening for binding partners via pull-down assays
Structural StudiesAnalyzing transmembrane topology and signaling conformations
Immune SignalingInvestigating TLR-mediated DC activation pathways
Functional AssaysAssessing GPCR activity in heterologous expression systems (e.g., HEK293 cells)

This protein is commercially available in lyophilized form for SDS-PAGE, ELISA, and Western blotting .

Evolutionary and Therapeutic Significance

  • Deciphering conserved GPCR signaling mechanisms.

  • Developing biased agonists targeting immune pathways .

  • Exploring receptor-ligand dynamics in non-human species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr33; Probable G-protein coupled receptor 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDLINSSTHVINVSTSLTNSTGVPTPAPKTIIAASLFMAFIIGVISNGLYLWMLQFKMQR TVNTLLFFHLILSYFISTLILPFMATSFLQDNHWVFGSVLCKAFNSTLSVSMFASVFFLS AISVARYYLILHPVWSQQHRTPHWASRIALQIWISATILSIPYLVFRTTHDDHKGRIKCQ NNYIVSTDWESKEHQTLGQWIHAACFVGRFLLGFLLPFLVIIFCYKRVATKMKEKGLFKS SKPFKVMVTAVISFFVCWMPYHVHSGLVLTKSQPLPLHLTLGLAVVTISFNTVVSPVLYL FTGENFKVFKKSILALFNSTFSDISSTERTQTLNSETEI
Uniprot No.

Target Background

Function
Orphan receptor; could be a chemoattractant receptor.
Gene References Into Functions
  1. Interestingly, the naturally occurring mutation of Arg(3.50) to His in GPR33 exhibited no significant difference from the wild-type receptor in several functional tests. PMID: 16595170
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in lung, spleen and testis.

Q&A

What functional classification does Gpr33 belong to?

Gpr33 belongs to the Class A (rhodopsin-like) family of G-protein coupled receptors. It is categorized as an orphan receptor, meaning its endogenous ligand has not been definitively identified. Structurally and functionally, it shows similarity to chemokine receptors, particularly ChemR23, formyl peptide receptors, and other chemokine receptors involved in immune system functions . This receptor is part of a larger group of GPCRs that have diverse signaling capabilities but shared structural characteristics.

How is Gpr33 expressed in murine tissues?

Gpr33 shows a tissue-specific expression pattern with particularly high expression in immune cells and lymphoid tissues. Most notably:

  • Dendritic cells (DCs) express high levels of Gpr33 mRNA

  • Lymphoid organs including spleen, thymus, and lymph nodes show significant expression

  • Lung tissue also expresses Gpr33, especially following appropriate stimulation

Expression patterns can be significantly modulated by immune stimulation, particularly through toll-like receptor (TLR) activation. For instance, treatment with poly I:C (a TLR3 activator) or R-848 (a TLR7 activator) significantly increases Gpr33 expression in lymphoid organs in vivo .

What are the recommended storage and reconstitution protocols for recombinant Gpr33?

For optimal stability and activity of recombinant Gpr33, the following protocol is recommended:

  • Storage: Store the lyophilized protein at -20°C to -80°C upon receipt. Working aliquots can be kept at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Reconstitution process:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is standard)

    • Aliquot for long-term storage at -20°C/-80°C

This methodology ensures protein stability while minimizing degradation during experimental procedures.

How is Gpr33 expression regulated at the molecular level?

Gpr33 expression is tightly regulated by specific signaling pathways associated with innate immunity. The molecular mechanisms include:

  • TLR-mediated regulation: Multiple toll-like receptor activators increase Gpr33 mRNA transcription. These include:

    • Poly I:C (TLR3 activator)

    • R-848 (TLR7 activator)

    • LPS (TLR4 activator)

    • Zymosan A (TLR2/6 activator)

  • Signaling pathway involvement: Gpr33 transcription is regulated through:

    • NF-κB signaling pathways (inhibited by celastrol and BAY)

    • AP-1 signaling cascades (inhibited by U-0126 and NDGA)

  • Protein synthesis requirement: Cycloheximide, a protein synthesis inhibitor, blocks poly I:C-induced increase in Gpr33 mRNA levels, indicating that the TLR-induced expression pathway requires additional protein components, likely "early transcripts" induced by TLR activation .

This complex regulatory mechanism positions Gpr33 as an early transcriptional target of innate immune responses, particularly those associated with viral recognition pathways.

What is the evolutionary significance of Gpr33 pseudogenization across species?

The evolutionary trajectory of Gpr33 presents a fascinating case of convergent pseudogenization with significant implications for pathogen resistance:

These findings suggest that while Gpr33 plays a role in innate immunity, its inactivation may represent an evolutionary adaptation to avoid exploitation by specific pathogens.

How can researchers functionally characterize Gpr33 signaling pathways?

Given that Gpr33 is an orphan receptor without known endogenous ligands, several innovative approaches can be employed to investigate its signaling capabilities:

  • Optical functionalization: Engineering chimeric receptors that contain the signaling domains of Gpr33 functionally linked to the light-sensing domain of rhodopsin. This approach allows activation with visible light rather than unknown chemical activators . Benefits include:

    • Precise temporal control of receptor activation

    • Avoidance of off-target effects from unknown ligands

    • Ability to test multiple downstream signaling pathways

  • Pathway analysis: Upon stimulation of these engineered receptors, researchers can identify activation of canonical cell signaling pathways, including:

    • cAMP-dependent pathways

    • Ca²⁺-dependent pathways

    • MAPK/ERK-dependent pathways

    • Rho-dependent pathways

  • Resurrection studies: For pseudogenized versions (like human GPR33), researchers can "resurrect" signaling functions by reverting the inactivating mutations, allowing investigation of the receptor's hypothesized roles, such as being a pathogen entry site .

This methodological approach provides a valuable tool for exploring the physiology and therapeutic potential of understudied GPCRs like Gpr33.

What chemical modulators affect Gpr33 expression and function?

Several chemical compounds have been identified that can modulate Gpr33 expression, providing tools for experimental manipulation:

Chemical CompoundEffect on Gpr33Experimental EvidenceReference
AmphetamineIncreases expressionDirect experimental evidencePMID:30779732
Bisphenol ADecreases expressionDirect experimental evidencePMID:25181051
EpoxiconazoleIncreases expressionBased on mouse Gpr33 evidencePMID:35436446
N-ethyl-N-nitrosoureaIncreases mutagenesisBased on mouse Gpr33 evidencePMID:16720677
OzoneDecreases expressionBased on mouse Gpr33 evidencePMID:33026818
Valproic acidAffects expressionBased on mouse Gpr33 evidencePMID:17292431
VinclozolinIncreases promoter methylationDirect experimental evidencePMID:20927350

These chemical interactions provide valuable tools for experimental manipulation of Gpr33 in research settings and highlight potential environmental factors that might influence Gpr33 biology.

What are the optimal expression systems for producing functional recombinant Gpr33?

When designing experiments requiring recombinant Gpr33, researchers should consider the following expression system options:

  • Bacterial expression (E. coli):

    • Advantages: High yield, cost-effective, established protocols

    • Limitations: Potential for improper folding of transmembrane domains, lack of post-translational modifications

    • Recommended for: Structural studies, antibody generation, protein interaction studies

    • Protocol enhancement: Expression as fusion proteins with solubility tags like His-tag

  • Mammalian expression systems:

    • Advantages: Proper folding, post-translational modifications, appropriate membrane insertion

    • Limitations: Lower yield, higher cost, more complex protocols

    • Recommended for: Functional studies, signaling assays, ligand binding studies

    • Cell lines to consider: HEK293, CHO-K1, NIH/3T3

  • Insect cell expression systems:

    • Advantages: Higher yield than mammalian cells, appropriate folding of GPCRs

    • Limitations: Different glycosylation patterns than mammalian cells

    • Recommended for: Large-scale production of functional receptor

For functional studies analyzing signaling pathways, mammalian expression systems are preferable despite lower yields, as they ensure proper receptor folding and membrane insertion critical for GPCR functionality.

What experimental design considerations are important when studying Gpr33's role in innate immunity?

Given Gpr33's involvement in innate immunity, researchers should consider the following experimental design elements:

  • Cell type selection:

    • Primary dendritic cells (highest expression)

    • Bone marrow-derived dendritic cells (for in vitro culture)

    • Lymphoid tissue cells (spleen, thymus, lymph nodes)

    • Lung tissue cells (especially for respiratory infection models)

  • Stimulation protocols:

    • TLR activators for expression modulation:

      • Poly I:C (40 μg/ml) for TLR3 activation

      • R-848 (1 μg/ml) for TLR7 activation

      • LPS (5 μg/ml) for TLR4 activation

      • Zymosan A (50 μg/ml) for TLR2/6 activation

    • Treatment duration: 8 hours optimal for most stimulations

    • In vivo treatments: Intraperitoneal or nasal application routes depending on target tissues

  • Signaling pathway analysis:

    • Use of specific inhibitors:

      • NF-κB pathway: celastrol (250 nM) or BAY (100 μM)

      • AP-1 pathway: NDGA (5 μM) or U-0126 (50 μM)

      • Protein synthesis: cycloheximide (50 μg/ml)

    • Preincubation time with inhibitors: 30 minutes before stimulation

  • Species considerations:

    • Use mice with intact Gpr33 (not all mouse strains have functional Gpr33)

    • Consider the pseudogenization status when translating findings to human applications

This systematic approach allows for comprehensive investigation of Gpr33's role in immune responses to various pathogens and inflammatory stimuli.

How can researchers reconcile contradictory findings regarding Gpr33's function across different species?

The pseudogenization of Gpr33 in humans and some rodents creates challenges when interpreting experimental results across species. To address contradictory findings:

  • Phylogenetic approach:

    • Compare Gpr33 sequences across species to identify conserved domains that may maintain functionality despite pseudogenization

    • Examine related receptors that may have assumed Gpr33's functions in species where it became pseudogenized

  • Functional complementation studies:

    • Express the intact mouse Gpr33 in human cell lines to determine if it can rescue immune functions

    • Create "resurrected" versions of human GPR33 by repairing the premature stop codon

    • Compare signaling outcomes between intact and pseudogenized versions

  • Systems biology approach:

    • Map the interactome of Gpr33 in species where it remains functional

    • Identify compensatory changes in signaling networks in species with pseudogenized Gpr33

    • Use transcriptomics to compare immune responses between species with and without functional Gpr33

  • Pathogen challenge models:

    • Test susceptibility to specific pathogens in animals with functional versus non-functional Gpr33

    • Focus on pathogens that co-evolved with species showing Gpr33 pseudogenization

By implementing these analytical approaches, researchers can develop a more nuanced understanding of how Gpr33 functions have evolved and potentially been compensated for in species where the gene has been inactivated.

What are the promising approaches for identifying the endogenous ligand(s) of Gpr33?

Despite being an orphan receptor, several methodologies show promise for identifying Gpr33's natural ligand(s):

  • Proximity-based ligand screening:

    • Express Gpr33 with proximity labeling tags (BioID, APEX)

    • Expose to tissue extracts where Gpr33 is naturally expressed

    • Identify molecules that interact with the receptor using mass spectrometry

  • Functional screening platforms:

    • Develop cell-based assays using the engineered optogenetic Gpr33 as a positive control

    • Screen libraries of:

      • Chemokines and cytokines (given structural similarity to chemokine receptors)

      • Pathogen-derived molecules (considering its hypothesized role as a pathogen entry site)

      • Lipid mediators (common ligands for orphan GPCRs)

  • Computational approaches:

    • Structure-based virtual screening based on homology models

    • Analysis of transcriptional co-regulation patterns with known ligand-producing enzymes

    • Machine learning to predict potential ligands based on receptor sequence and structure

  • Evolutionary approach:

    • Identify endogenous molecules that are differentially regulated in species with pseudogenized versus functional Gpr33

    • Focus on immune mediators specifically produced during pathogen challenges that selected for Gpr33 inactivation

These multifaceted approaches, when combined, increase the likelihood of identifying the elusive natural ligand(s) of Gpr33.

How might understanding Gpr33 pseudogenization inform host-pathogen interaction studies?

The pattern of Gpr33 pseudogenization across species provides unique insights for host-pathogen research:

  • Pathogen identification strategies:

    • Search for pathogens common to habitats shared by humans, rats, and gerbils (all with pseudogenized Gpr33)

    • Focus on pathogens that emerged or became prevalent within the last 1 million years (timeframe of Gpr33 pseudogenization)

    • Investigate zoonotic pathogens like Yersinia pestis and hantaviruses specifically

  • Receptor exploitation mechanisms:

    • Test whether functional Gpr33 facilitates entry or replication of specific pathogens

    • Examine whether pathogens produce Gpr33 agonists as virulence factors

    • Determine if Gpr33 activation modulates immune responses favorably for pathogen survival

  • Comparative immunology approaches:

    • Compare immune responses to specific pathogens between species with functional versus pseudogenized Gpr33

    • Examine whether other immune receptors compensate for Gpr33 loss in humans and other species

  • Evolutionary immunogenetics:

    • Analyze population genetics and fixation rates of the Gpr33 null allele in relation to historical disease outbreaks

    • Investigate whether European populations (with near-fixation of the null allele) experienced specific selection pressures from pathogens

This research direction could potentially identify novel host-pathogen interactions and explain evolutionary adaptations in immune system components.

How can the optical functionalization of Gpr33 advance GPCR research methodologies?

The engineered chimeric receptors containing Gpr33 signaling domains linked to light-sensing domains of rhodopsin represent a significant technological advancement with several applications:

  • Precise spatiotemporal control:

    • Ability to activate specific cell populations expressing the engineered receptor

    • Capacity to study the kinetics of Gpr33 signaling with millisecond precision

    • Potential to investigate how signal duration affects downstream pathway activation

  • Bypassing ligand limitations:

    • Circumvents the need for identifying the endogenous ligand

    • Eliminates concerns about ligand specificity or off-target effects

    • Provides a standardized activation method for comparing different GPCRs

  • Pathway dissection capabilities:

    • Enables systematic testing of Gpr33 coupling to various G-protein subtypes

    • Facilitates identification of canonical pathways activated downstream of Gpr33, including:

      • cAMP-dependent pathways

      • Ca²⁺-dependent pathways

      • MAPK/ERK-dependent pathways

      • Rho-dependent pathways

  • Translational applications:

    • Development of optically controlled cellular immunotherapies

    • Creation of reporter systems for monitoring immune activation in real-time

    • Design of optogenetic tools for manipulating immune responses in experimental models

This technological approach provides a versatile platform for studying not just Gpr33, but potentially any orphan GPCR for which ligand information is limited or absent.

What analytical techniques are most effective for assessing Gpr33 expression in tissue samples?

Researchers investigating Gpr33 should consider these analytical approaches for optimal detection and quantification:

  • Quantitative PCR (qPCR):

    • Most reliable for detecting Gpr33 mRNA expression changes

    • Protocol considerations:

      • Primer design should span exon-exon junctions

      • Reference genes should be validated for stability under experimental conditions

      • Special considerations for pseudogene detection in humans

  • RNA-Seq and transcriptomic analysis:

    • Provides broader context of gene expression changes

    • Allows detection of potential splice variants

    • Enables correlation with other immune-related genes

  • Immunohistochemistry/Immunofluorescence:

    • Challenges exist due to limited availability of specific antibodies

    • Validation approaches:

      • Use of tagged recombinant Gpr33 as control

      • Comparison with mRNA expression patterns

      • Knockout/knockdown controls

  • Single-cell analysis techniques:

    • Single-cell RNA-Seq to identify specific cell populations expressing Gpr33

    • Mass cytometry (CyTOF) with metal-tagged antibodies for high-dimensional analysis

    • Spatial transcriptomics to map Gpr33 expression within tissue architecture

Each technique offers different advantages, and combining multiple approaches provides the most comprehensive assessment of Gpr33 expression in experimental or clinical samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.