Recombinant Mouse Probable G-protein coupled receptor 37 (Gpr37)

Shipped with Ice Packs
In Stock

Description

Introduction to GPR37 and Recombinant Mouse Gpr37

G-protein coupled receptor 37 (GPR37) is a class A orphan GPCR primarily expressed in the central nervous system (CNS), with significant roles in neuroprotection, dopamine signaling, and neurodegenerative disease pathology . The recombinant mouse Gpr37 protein is a bioengineered version of the endogenous receptor, designed for structural and functional studies. It is produced via bacterial expression systems (e.g., E. coli) and includes modifications such as N-terminal His-tagging for purification and solubility .

Primary Structure

The recombinant mouse Gpr37 spans amino acids 27–600, corresponding to the mature protein sequence (UniProt ID: Q9QY42). Key features include:

  • His-tag: N-terminal fusion for affinity chromatography .

  • Transmembrane domains: Seven helical domains characteristic of GPCRs .

  • Proteolytic processing sites: Cleavage between E167 and Q168 in the N-terminus, a hallmark of endogenous GPR37 .

ParameterValueSource
Molecular weight~67–96 kDa (full-length)
Post-translational modificationsN-glycosylation, O-glycosylation
Sequence identity68% with human GPR37

Functional Domains

  • N-terminal ectodomain: Subject to constitutive proteolysis by ADAM-10, releasing ecto-GPR37 into the extracellular matrix .

  • C-terminal intracellular domain: Interacts with PDZ domain-containing proteins (e.g., HSPA1A, parkin) .

Production and Purification Methods

The recombinant mouse Gpr37 is synthesized in E. coli and purified via nickel affinity chromatography. Key steps include:

  1. Expression: Induced in E. coli using optimized media for high-yield production .

  2. Purification:

    • Solubility: Reconstituted in Tris/PBS buffer with 6% trehalose .

    • Purity: >90% confirmed by SDS-PAGE .

ParameterOptimal ConditionRationale
Storage bufferTris/PBS, pH 8.0, 6% trehalosePrevent aggregation, maintain stability
ReconstitutionSterile water (0.1–1.0 mg/mL)Minimize denaturation

Physiological Functions

  • Dopamine regulation: Associates with the dopamine transporter (DAT) to modulate presynaptic DA uptake and locomotor activity .

  • Wnt/β-catenin signaling: Enhances LRP6 cell surface expression, promoting neuroprotection .

  • Oligodendrocyte differentiation: Required for myelination and remyelination in the spinal cord .

Pathological Roles

  • Parkinson’s disease (PD):

    • Proteolytic processing: Increased ecto-GPR37 in CSF correlates with PD progression .

    • ER stress: GPR37 aggregates in Lewy bodies, exacerbating dopaminergic neuron death .

  • Cancer: Upregulation in gliomas and gastric tumors linked to proliferation and metastasis .

Key Studies

ApplicationMethodOutcomeSource
Proteolytic processingADAM-10 inhibition assaysReduced ecto-GPR37 shedding
Wnt signalingTopflash reporter assaysLRP6-dependent β-catenin activation
DAT interactionCo-immunoprecipitationEnhanced DAT plasma membrane localization

Mechanistic Insights

  • GPR37-DAT complex: Co-localized in striatal presynaptic membranes, modulating cocaine sensitivity and catalepsy .

  • Parkin interaction: E3 ubiquitin ligase parkin targets misfolded GPR37 for degradation, mitigating ER stress .

Comparative Analysis of GPR37 and GPR37L1

FeatureGPR37GPR37L1
Surface expressionLow (requires N-terminal truncation)High (native expression)
Ligand bindingProsaposin, osteocalcinProsaposin analogs
Tissue distributionDopaminergic neurons, oligodendrocytesCerebellar astrocytes

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
Gpr37; Prosaposin receptor GPR37; G-protein coupled receptor 37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-600
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ALSFVPEPRNGTCLGESCSPLIQRRSRDARGPGNSAKDALRVHVPREKLEAEVRGATSWD LPPPRGGDTGVIEEAAAAGPLGPPTKPPSAWRWKSAQGKEPSGHLRRRDPTDPQLFFPTS EGGEMSSKRDGIPQSRQEHSVKTEPRDLFYWPRRTGQLQDSQHRPSAVHEGRTLAPPGRA LPQNGSADDWVPDQGGPRRGNTTRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGN LAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPY IEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVV LRQLSKEDLGFSGQAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTLFTI TCSLVTARKIRKAEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTAYMA TGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECCCCCCEECIQKSSTVT SDDNDNEYTTELELSPFSTIRREMSTFASVGTHC
Uniprot No.

Target Background

Function

Probable G-protein coupled receptor 37 (GPR37) is a receptor for the neuroprotective and glioprotective factor prosaposin. Ligand binding initiates endocytosis, followed by an ERK phosphorylation cascade.

Gene References Into Functions
Gene References and Functional Studies:
  1. Gpr37-/- mice exhibit significantly increased myelin loss in response to cuprizone. PMID: 28642167
  2. GPR37 is crucial for cellular protein quality control during Wnt signaling. PMID: 28341812
  3. GPR37 regulates central nervous system myelination by controlling the transition from early-differentiated to mature oligodendrocytes. PMID: 26961174
  4. GPR37 knockout triggers anxiolytic-like effects and regulates hippocampal A2AR-mediated signaling. PMID: 25824528
  5. Functional association exists between GPR37, prosaposin, and GM1 ganglioside in the plasma membrane. PMID: 24371137
  6. GPR37 knockout mice show age and sex-specific improvements in olfaction, along with increased anxiety and depression-like behaviors. PMID: 23574697
  7. Retrograde infection-induced Pael-R upregulation in the substantia nigra pars compacta causes endoplasmic reticulum (ER) stress and dopaminergic neuron death. PMID: 17116640
  8. GPR37 associates with the dopamine transporter, modulating dopamine uptake and behavioral responses to dopaminergic drugs. PMID: 17519329
  9. GPR37 overexpression induces cellular autophagy, potentially preventing selective degeneration of GPR37-expressing neurons in Parkinson's and related diseases. PMID: 19218498
  10. Macroautophagy of the GPR37 orphan receptor and Parkinson disease-associated neurodegeneration PMID: 19398891
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the expression pattern of Gpr37 in mouse tissues?

Gpr37 exhibits notable tissue-specific expression patterns in mice, with particularly high expression in neural tissues. The gene is abundantly expressed in oligodendrocytes and neurons of specific brain regions, most prominently in the substantia nigra and hippocampus . This distribution pattern is significant for understanding the receptor's physiological functions in these regions. The expression profile suggests potential roles in neuronal signaling and glial cell function, particularly in areas associated with motor control and memory formation .

In contrast to Gpr37, its paralog Gpr37l1 shows markedly different expression, being predominantly found in cerebellar Bergmann glia astrocytes . This differential expression between the two related receptors indicates distinct physiological roles despite their structural similarities. Researchers investigating Gpr37 should consider these tissue-specific expression patterns when designing experiments and interpreting results, as the receptor's function may vary depending on the cellular context and brain region being studied .

What are the known ligands for recombinant mouse Gpr37?

For many years, Gpr37 remained an orphan receptor with no identified endogenous ligands, despite sequence similarity to endothelin receptors suggesting peptide activation. Breakthrough research has identified prosaptide and its parent protein prosaposin (also known as sulfated glycoprotein-1) as functional ligands for both Gpr37 and Gpr37l1 . These findings represent a significant advancement in understanding Gpr37's physiological role and signaling mechanisms.

Experimental evidence demonstrates that prosaptide promotes Gpr37 endocytosis, binds directly to the receptor, and activates downstream signaling in a Gpr37-dependent manner . Previous hypotheses that Gpr37 might be activated by endothelins or endothelin-related peptides have yielded negative results, confirming the specificity of the prosaptide-Gpr37 interaction . It's worth noting that earlier studies suggested a neuropeptide called "head activator" derived from Hydra might bind to Gpr37, but subsequent research has not substantiated the existence of a vertebrate ortholog of this peptide . The identification of prosaposin and prosaptide as ligands has significant implications for designing experiments to study Gpr37 function and potential therapeutic interventions targeting this receptor.

How does post-translational processing affect Gpr37 function?

Post-translational processing fundamentally impacts Gpr37 functionality, with proteolytic processing of the receptor's N-terminus representing a critical regulatory mechanism. Research demonstrates that although Gpr37 matures and exports from the endoplasmic reticulum normally, its long extracellular N-terminus undergoes metalloproteinase-mediated limited proteolysis between amino acid residues E167 and Q168 . This proteolytic processing occurs rapidly and constitutively, suggesting it is an intrinsic aspect of Gpr37 regulation rather than a pathological event.

Immunofluorescence microscopy has established that while full-length receptors are present throughout the secretory pathway until the trans-Golgi network, Gpr37 predominantly exists in its N-terminally truncated form at the cell surface . This phenomenon has been verified through flow cytometry and cell surface biotinylation assays. Additionally, the Gpr37 ectodomain is released from cells by shedding, a process rarely observed with G protein-coupled receptors (GPCRs) . This shedding may have significant implications for receptor signaling and potential paracrine effects. These post-translational modifications could explain some of the challenges in studying Gpr37 function and may have important implications for understanding its role in Parkinson's disease pathophysiology and general neuronal function .

What signaling pathways are activated by Gpr37?

Gpr37 activates multiple intracellular signaling cascades, primarily operating through Gαi/o protein-coupled mechanisms. Experimental evidence indicates that Gpr37 signaling is sensitive to pertussis toxin, confirming the involvement of Gαi/o proteins in signal transduction . Upon activation by ligands such as prosaptide or prosaposin, Gpr37 triggers several downstream pathways that collectively influence cellular responses and survival mechanisms.

The primary signaling events following Gpr37 activation include inhibition of adenylyl cyclase leading to decreased cAMP levels, inhibition of exchange protein activated by cAMP (EPAC)-mediated signaling, activation of membrane calcium channels facilitating extracellular Ca²⁺ influx, enhanced extracellular signal-regulated kinase (ERK) phosphorylation, and activation of the mitogen-activated protein kinase (MAPK) pathway . In heterologous expression systems, Gpr37 stimulation with prosaptide induces ERK phosphorylation in a pertussis toxin-sensitive manner, stimulates ³⁵S-GTPγS binding, and promotes inhibition of forskolin-stimulated cAMP production . Recent research has also demonstrated that Gpr37 signals through both heterotrimeric G proteins and β-arrestin proteins, leading to receptor endocytosis and activation of ERK through distinct pathways . This complex signaling profile suggests that Gpr37 may regulate multiple cellular processes through different effector mechanisms, explaining its diverse physiological roles.

How do Gpr37 knockout mouse models contribute to understanding receptor function?

Multiple Gpr37 knockout mouse strains have been developed and characterized, providing essential tools for investigating the receptor's physiological and pathological roles. The first constitutive Gpr37 knockout mutant strain was produced by crossing a conditional-ready mutant strain carrying a P1 bacteriophage locus of crossing over (loxP)-flanked (floxed) Gpr37-targeted allele with a transgenic strain ubiquitously expressing the P1 bacteriophage's recombination (cre recombinase) protein . These knockout models have enabled extensive in vivo and ex vivo analyses of Gpr37 receptor functions and involvement in brain and other organ pathologies.

Studies utilizing Gpr37 knockout mice have revealed crucial insights into the receptor's role in neurological function, particularly in dopaminergic signaling pathways. Research has demonstrated that Gpr37 is necessary for prosaptide and prosaposin-mediated neuroprotection, as knockout or knockdown of Gpr37 attenuates these protective effects in cellular models . Furthermore, these animal models have helped elucidate Gpr37's potential involvement in Parkinson's disease pathophysiology, given that the human GPR37 protein is a substrate of parkin, and its insoluble form accumulates in brain samples from patients with inherited juvenile Parkinson's disease .

When designing experiments using Gpr37 knockout mice, researchers should consider potential compensatory mechanisms, particularly involving the closely related Gpr37l1 receptor. Evidence suggests that while Gpr37 and Gpr37l1 share similar ligands and some signaling properties, they do not couple to exactly the same set of intracellular signaling pathways . This differential coupling may explain why knockdown of either receptor attenuates the protective actions of prosaptide and prosaposin against oxidative stress, while only Gpr37 appears necessary for prosaptide-induced ERK phosphorylation in primary astrocytes .

What methodologies are most effective for studying Gpr37 in experimental systems?

Investigating Gpr37 function requires a strategic combination of molecular, cellular, and in vivo approaches. For expression analysis, researchers have successfully employed quantitative PCR, in situ hybridization, and immunohistochemistry to characterize tissue-specific distribution patterns of Gpr37 . When studying protein processing and trafficking, techniques such as immunofluorescence microscopy, flow cytometry, and cell surface biotinylation assays have proven valuable for distinguishing between full-length and N-terminally truncated forms of the receptor at the cell surface .

For functional studies, heterologous expression systems using HEK293 and SH-SY5Y cells transfected with Gpr37 have been instrumental in characterizing ligand binding and signaling properties . These systems have demonstrated that Gpr37 is sufficient to confer G protein-mediated signaling by prosaptide and prosaposin when expressed in otherwise non-responsive cells . Signaling assays measuring ERK phosphorylation, GTPγS binding, and cAMP inhibition have effectively quantified Gpr37 activation .

A particularly innovative approach for studying Gpr37 involves optogenetic techniques. Gpr37 demonstrated the first channel rhodopsin 2 (ChR2)-GPCR approach, enabling selective activation of the receptor through optogenetics . This method allows for causal analysis of Gpr37 activity in specific cells and behavioral responses in freely moving animals. The specificity of opto-GPR37 signaling has been confirmed by the reduction of cAMP levels, enhanced ERK phosphorylation, and increased motor activity .

For in vivo studies, both conventional knockout approaches and conditional tissue-specific deletion models have provided valuable insights into Gpr37 function . Additionally, siRNA-mediated knockdown has been effective in primary cell cultures to assess the necessity of Gpr37 for specific cellular responses, such as protection against oxidative stress .

What is the relationship between Gpr37 and neurodegenerative disorders, particularly Parkinson's disease?

Gpr37 has significant implications in neurodegenerative disorders, with particularly strong evidence linking it to Parkinson's disease (PD) pathophysiology. The human GPR37 protein has been identified as a substrate of parkin, an E3 ubiquitin ligase encoded by the PARK2 gene, mutations in which cause autosomal recessive juvenile parkinsonism . In patients with inherited juvenile Parkinson's disease, the insoluble form of GPR37 accumulates in brain samples, suggesting a potential pathogenic mechanism involving impaired protein degradation .

Experimental evidence indicates that Gpr37 plays crucial roles in dopaminergic signaling and the survival of dopaminergic cells in animal models . These functions are particularly relevant to PD, which is characterized by the progressive loss of dopaminergic neurons in the substantia nigra. The identification of prosaptide and prosaposin as ligands for Gpr37 further strengthens the connection to neuroprotection, as these factors have been shown to protect neuronal and glial cells from various insults, including oxidative stress .

Research using primary astrocytes has demonstrated that both prosaptide and prosaposin protect against hydrogen peroxide-induced cell death, with these protective effects being attenuated by siRNA-mediated knockdown of endogenous astrocytic Gpr37 . This suggests that targeting the Gpr37-prosaposin signaling axis might represent a potential therapeutic strategy for PD and other neurodegenerative disorders characterized by oxidative stress and neuroinflammation.

When investigating Gpr37's role in PD, researchers should consider both its function in dopaminergic neurons, where it may directly affect cell survival, and its expression in glial cells, where it may contribute to neuroinflammatory processes and neuron-glia interactions . Additionally, the post-translational processing of Gpr37, particularly its N-terminal proteolysis and shedding, may influence its pathophysiological functions and could represent potential biomarkers or therapeutic targets in PD .

How does Gpr37 expression correlate with glioma progression and prognosis?

Recent evidence demonstrates significant associations between Gpr37 expression and glioma clinicopathological features, suggesting its potential as a prognostic biomarker. Analysis of data from The Cancer Genome Atlas (TCGA) databases reveals that elevated Gpr37 expression in glioma is significantly associated with several clinical factors, including CNS WHO grade, histological type, 1p/19q codeletion status, IDH mutation status, CDKN2A/B homozygous deletion, patient age, and primary therapy outcome . This multifaceted association pattern suggests that Gpr37 may be intimately involved in the molecular pathways driving glioma progression.

Univariate logistic regression analysis has shown significant correlations between Gpr37 mRNA expression and specific glioma characteristics. For instance, there is a correlation with CNS WHO grade (G4 vs. G2 & G3, OR = 0.380, 95% CI (0.069–0.692), P < 0.001), histological type (Glioblastoma, IDH wildtype vs. Oligodendroglioma, IDH mutation, 1p/19q-codel vs. Astroctyoma, IDH mutation, OR = 0.397, 95% CI (0.040–0.754), P < 0.001), CDKN2A/B homozygous deletion (non-homdel vs. homdel, OR = 1.865, 95% CI (1.495–2.234), P < 0.001), and age (≤60 vs. >60, OR = 1.466, 95% CI (1.095–1.836), P < 0.001) .

Experimental studies in glioma cell lines provide additional support for Gpr37's functional role in tumor biology. Upregulation of Gpr37 in human glioma U251 cells leads to increased proliferation, cell cycle alterations (decrease in G1/G0 phase cells, increase in S and G2 phase cells), and enhanced phosphorylation of p-AKT (Ser473) . The increased AKT phosphorylation suggests activation of signaling pathways associated with cell survival and proliferation, further supporting the notion that Gpr37 upregulation may contribute to glioma progression .

For researchers investigating Gpr37 in gliomas, these findings suggest several methodological approaches, including stratification of patient samples based on Gpr37 expression levels, correlation with established molecular markers (IDH status, 1p/19q codeletion), and functional studies manipulating Gpr37 expression in glioma cell lines to assess effects on proliferation, invasion, and therapy resistance.

What are the molecular mechanisms underlying Gpr37's role in cancer progression?

Gpr37 exhibits complex and context-dependent roles in cancer biology, with evidence supporting both tumor-promoting and tumor-suppressing functions depending on the cancer type. In carcinomas, gain- or loss-of-function assays have demonstrated that increased Gpr37 expression enhances the activation of TGF-β1, Smad2, and Smad3 phosphorylation, leading to improved proliferation, migration, and invasion of carcinoma cells in vitro . Conversely, knocking down Gpr37 impedes these malignant behaviors, suggesting a potential oncogenic function in certain contexts.

In lung adenocarcinoma (LUAD), Gpr37 plays a significant role in prognostic prediction models involving competitive endogenous RNA (ceRNA) and tumor-infiltrating immune cells (TIICs). Among three types of TIICs (Monocytes, Macrophages M1, activated mast cells) found to be significantly associated with LUAD prognosis, Gpr37 exhibits a particularly close relationship with Macrophages M1 . Additionally, protein-protein interaction networks suggest that Gpr37 genes are upregulated in samples with TP53/EGFR co-mutations, positioning it as a potential novel prognostic marker and therapeutic target for patients with dual TP53/EGFR mutation LUAD .

Interestingly, Gpr37 shows contrasting expression patterns and functions in different cancer types. While upregulated in some cancers, Gpr37 exhibits lower expression in human hepatocellular carcinoma (HuH7) compared to adjacent non-tumorous tissues . Transient knockdown of Gpr37 using siRNA in HuH7 cells has shown a significant decrease in hepatoma cell apoptosis by activating the phosphatidylinositol 3-kinase (PI3K)-Akt signaling pathway . In multiple myeloma cells, Gpr37 is implicated in regulating cell proliferation through the modulation of cell adhesion ability and AKT and ERK activity .

These diverse and sometimes contradictory findings highlight the importance of cancer-specific studies when investigating Gpr37's role in neoplastic processes. Researchers should carefully consider the cellular context, signaling environment, and potential interaction with other molecular pathways when designing experiments to elucidate Gpr37's function in specific cancer types.

What are the key considerations when developing cell-based assays for Gpr37?

When developing cell-based assays for Gpr37 research, researchers must address several critical factors to ensure reliable and reproducible results. First, the choice of cell line requires careful consideration. HEK293 and SH-SY5Y cells have been successfully used for heterologous expression of Gpr37 , but researchers should be aware that these cells may not recapitulate all aspects of the receptor's native environment. Primary astrocytes or neuronal cultures derived from mouse brain might provide more physiologically relevant systems, particularly when studying neuroprotective effects .

Second, researchers must account for Gpr37's post-translational processing when designing detection methods. Standard Western blotting or immunofluorescence techniques should incorporate antibodies targeting both N-terminal and C-terminal epitopes to distinguish between full-length and processed forms of the receptor . Flow cytometry and cell surface biotinylation assays have proven effective for quantifying cell surface expression specifically .

Third, when establishing functional assays, multiple readouts should be incorporated to capture the diverse signaling pathways activated by Gpr37. These include ERK phosphorylation assays, cAMP inhibition assays, calcium mobilization assays, and GTPγS binding assays . Researchers should also consider the pertussis toxin sensitivity of Gpr37 signaling, which can serve as a control to confirm the involvement of Gαi/o proteins .

Finally, ligand selection and preparation are crucial considerations. Prosaptide and prosaposin have been identified as endogenous ligands for Gpr37 , but researchers should be mindful of potential cross-reactivity with Gpr37l1. To distinguish between effects mediated by these two related receptors, siRNA knockdown or genetic knockout approaches should be incorporated into experimental designs . Additionally, optogenetic approaches using ChR2-GPCR (opto-GPR37) systems offer innovative methods for selectively activating Gpr37 signaling in specific cells .

How can researchers effectively differentiate between Gpr37 and Gpr37l1 functions in experimental models?

Differentiating between the functions of the closely related receptors Gpr37 and Gpr37l1 presents a significant challenge in experimental design. These receptors share substantial sequence homology and respond to the same ligands (prosaptide and prosaposin), yet evidence suggests they serve distinct physiological roles . Several experimental strategies can help researchers delineate their specific functions.

First, exploiting differential expression patterns provides a natural approach to distinguishing between these receptors. Gpr37 transcripts are most abundant in oligodendrocytes and neurons of the substantia nigra and hippocampus, while Gpr37l1 is markedly expressed in cerebellar Bergmann glia astrocytes . By selecting specific brain regions or cell types for study, researchers can at least partially isolate the effects of one receptor over the other.

Second, selective genetic manipulation through knockout or knockdown strategies offers a powerful approach. Single knockout mouse strains for either Gpr37 or Gpr37l1, as well as double knockout models, can help identify receptor-specific phenotypes . In cell culture systems, siRNA-mediated knockdown of either or both receptors can reveal their individual contributions to specific cellular responses . For instance, knockdown experiments in primary astrocytes have shown that while both Gpr37 and Gpr37l1 contribute to protection against oxidative stress, only Gpr37 appears necessary for prosaptide-induced ERK phosphorylation .

Third, examining receptor-specific signaling pathways may provide insight into functional differences. Though both receptors couple to Gαi/o proteins, evidence suggests they do not engage identical downstream effectors . Comprehensive signaling profiling using phosphoproteomic approaches or pathway-specific inhibitors could help identify receptor-specific signaling signatures. Additionally, investigating potential differences in ligand binding affinity, receptor trafficking, or post-translational modifications between Gpr37 and Gpr37l1 might reveal functional distinctions.

Finally, researchers should consider potential receptor heterodimerization or cross-regulation between Gpr37 and Gpr37l1, which could complicate the interpretation of experimental results. Co-immunoprecipitation studies and bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) approaches might help identify physical interactions between these receptors that could influence their signaling properties.

What therapeutic potential does targeting Gpr37 hold for neurological disorders?

Gpr37 represents a promising therapeutic target for various neurological disorders, particularly Parkinson's disease, given its established roles in neuroprotection and dopaminergic signaling. The identification of prosaptide and prosaposin as endogenous ligands for Gpr37 has opened new avenues for drug development targeting this receptor . These ligands have demonstrated neuroprotective and glioprotective effects in multiple experimental systems, with their protective actions being mediated at least partly through Gpr37 .

The pertussis toxin sensitivity of Gpr37 signaling indicates coupling to Gαi/o proteins, suggesting that both agonists and positive allosteric modulators could be developed to enhance receptor activity in pathological conditions . Given Gpr37's role in protecting cells against oxidative stress, such compounds might be particularly valuable in neurodegenerative disorders characterized by oxidative damage, including Parkinson's disease, Alzheimer's disease, and amyotrophic lateral sclerosis .

Innovative approaches for targeting Gpr37 include optogenetic methods. The development of opto-GPR37, which enables selective activation of Gpr37 signaling through light stimulation, offers precise temporal and spatial control over receptor activity . This approach could be valuable for both basic research and potential therapeutic applications, allowing for targeted activation of neuroprotective pathways in specific brain regions.

Additionally, the N-terminal proteolytic processing of Gpr37 represents another potential therapeutic avenue . Modulating this processing through metalloproteinase inhibitors or developing antibodies or small molecules that specifically recognize and target either the full-length or truncated forms of the receptor could provide novel therapeutic strategies. Furthermore, the shedding of the Gpr37 ectodomain suggests that soluble fragments of the receptor might themselves have biological activity, potentially offering opportunities for peptide-based therapeutics .

How might Gpr37-targeted approaches be developed for cancer treatment?

Gpr37's complex roles in cancer biology suggest multiple potential therapeutic strategies, depending on the specific cancer type and molecular context. In gliomas and certain other cancers where Gpr37 appears to promote tumor progression, inhibitory approaches targeting the receptor or its downstream signaling pathways could be beneficial . These might include small molecule antagonists, function-blocking antibodies, or siRNA/shRNA-based gene silencing strategies.

Research has demonstrated that Gpr37 upregulation in glioma cells leads to increased proliferation and enhanced AKT signaling . Therefore, combination approaches targeting both Gpr37 and the PI3K/AKT pathway might provide synergistic benefits in glioma treatment. Additionally, the close relationship between Gpr37 and Macrophages M1 in lung adenocarcinoma suggests potential immunomodulatory approaches that could enhance anti-tumor immune responses .

Conversely, in contexts where Gpr37 exhibits tumor-suppressive properties, such as certain hepatocellular carcinomas, agonist approaches might be more appropriate . Stimulating Gpr37 activity through synthetic agonists or positive allosteric modulators could potentially enhance its growth-inhibitory effects in these specific cancer types.

The association between Gpr37 expression and various clinical factors in glioma, including IDH mutation status and 1p/19q codeletion, suggests that Gpr37-targeted therapies might be most effective when tailored to specific molecular subtypes . Precision medicine approaches incorporating Gpr37 expression analysis alongside other molecular markers could help identify patients most likely to benefit from such targeted interventions.

As with all targeted cancer therapies, potential resistance mechanisms should be anticipated and investigated proactively. These might include receptor mutations affecting ligand binding or signaling, compensatory activation of parallel pathways, or adaptive changes in receptor expression or processing. Combination approaches targeting multiple aspects of Gpr37 biology or incorporating Gpr37-targeted agents with conventional chemotherapy or immunotherapy might help mitigate these resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.