Recombinant Mouse Probable G-protein coupled receptor 75 (Gpr75)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant mouse GPR75 is synthesized using cell-free protein synthesis (CFPS) systems, which replicate in vitro translation machinery from plant lysates (e.g., Nicotiana tabacum) . This method enables high-yield production of challenging proteins without post-translational modifications.

Key Steps

  1. Expression: DNA encoding GPR75 (AA 1-540) is transcribed and translated in CFPS lysates.

  2. Purification: Strep-tag affinity chromatography isolates the protein (>70-80% purity by SDS-PAGE and Western blot) .

  3. Quality Control: Analytical SEC (HPLC) and SDS-PAGE confirm monodispersity and molecular weight .

Primary Applications

ApplicationPurposeExperimental Evidence
SDS-PAGEVerify molecular weight and purity
Western BlottingConfirm expression levels and epitope recognition
ELISAQuantify receptor-ligand interactions (e.g., CCL5/RANTES binding)
Signaling Pathway AnalysisStudy Gq/11 protein coupling and downstream calcium mobilization/inositol trisphosphate production

Research Findings and Biological Relevance

Studies using recombinant GPR75 and knockout (KO) mouse models reveal critical roles in metabolism and neurobiology:

Metabolic Regulation

  • Obesity Resistance: Gpr75 KO mice exhibit reduced adiposity (1.8 kg/m² lower BMI) and improved glucose tolerance (23-26% lower glucose AUC) .

  • Hypophagia: Reduced food intake contributes to lean phenotype in KO mice .

Neurological Functions

  • Synaptic Plasticity: Gpr75 KO mice show downregulated synaptic markers (synapsin I/II) and impaired contextual memory in hippocampal-dependent tasks .

  • Anxiety Modulation: Altered anxiety-like behaviors in KO models suggest GPR75’s role in CNS signaling .

Signaling Pathways

  • Gq/11 Coupling: Recombinant GPR75 activates phospholipase C, leading to calcium mobilization and PKC activation .

  • Cancer and Hypertension: 20-HETE binding to GPR75 triggers vasoconstrictive and pro-cancerous pathways (e.g., NF-κB, MAPK) .

Comparative Data: Recombinant GPR75 Production Platforms

ParameterCell-Free CFPS (Mouse GPR75)Mammalian Systems (Human GPR75)
Host SystemNicotiana tabacum lysateHEK-293 cells
YieldHigh (no host cell constraints)Moderate (depends on cell health)
Post-Translational ModificationsAbsent (e.g., glycosylation)Present (e.g., glycosylation)
ApplicationsStructural studies, ELISAFunctional assays, signaling studies

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
Gpr75; Probable G-protein coupled receptor 75
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-540
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNTSAPLQNVPNATLLNMPPLHGGNSTSLQEGLRDFIHTATLVTCTFLLAIIFCLGSYGN FIVFLSFFDPSFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFVLFFSSASSIPDSFCFT FHLTSSGFVIMSLKMVAVIALHRLRMVMGKQPNCTASFSCILLLTLLLWATSFTLATLAT LRTNKSHLCLPMSSLMDGEGKAILSLYVVDFTFCVAVVSVSYIMIAQTLRKNAQVKKCPP VITVDASRPQPFMGASVKGNGDPIQCTMPALYRNQNYNKLQHSQTHGYTKNINQMPIPSA SRLQLVSAINFSTAKDSKAVVTCVVIVLSVLVCCLPLGISLVQMVLSDNGSFILYQFELF GFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLRYTGLGFLCCKQKTRLRAMGKGNLEINRN KSSHHETNSAYMLSPKPQRKFVDQACGPSHSKESAASPKVSAGHQPCGQSSSTPINTRIE PYYSIYNSSPSQQESGPANLPPVNSFGFASSYIAMHYYTTNDLMQEYDSTSAKQIPIPSV
Uniprot No.

Target Background

Function
This G protein-coupled receptor is activated by the chemokine CCL5/RANTES. It is likely coupled to heterotrimeric Gq proteins, stimulating inositol trisphosphate production and calcium mobilization upon activation. In conjunction with CCL5/RANTES, it may play a role in neuron survival by activating a downstream signaling pathway involving PI3, Akt, and MAP kinases. CCL5/RANTES might also regulate insulin secretion by pancreatic islet cells through activation of this receptor.
Gene References Into Functions
  1. While CCL5 is associated with the pathogenesis of diabetes via activation of CCRs, it has beneficial effects on beta cells through GPR75 activation. PMID: 23979485
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain and heart. Also detected in skeletal muscle, liver and kidney. Also expressed by islet cells (at protein level).

Q&A

What is the molecular structure of Gpr75 and how does it compare to other GPCRs?

A particularly notable feature of GPR75 is the absence of the highly conserved P5.50 residue found in most Class A GPCRs. Instead, GPR75 contains C214 at position 5.50, a substitution present in only 1.7% of human Class A GPCRs (specifically in GPR148, LGR5, LGR6, and MRGRE) . This substitution results in a more straight and rigid conformation of transmembrane helix 5 (TM5), potentially reducing flexibility in response to ligand binding .

The orthosteric ligand binding pocket of GPR75 comprises numerous polar and hydrophobic residues, creating a distinctive environment for ligand interactions that may facilitate novel drug discovery approaches .

What are the confirmed ligands for GPR75 and their binding sites?

GPR75 was previously considered an "orphan receptor" but has been "deorphanized" with the identification of at least two distinct ligands:

  • 20-Hydroxyeicosatetraenoic acid (20-HETE): This cytochrome P450-derived eicosanoid activates GPR75, triggering a signaling pathway that increases endothelial angiotensin converting enzyme (ACE) expression and promotes hypertension . Computational docking analysis has identified a putative binding site for 20-HETE located between transmembranes five and six on GPR75 (SiteScore: 1.182 and Dscore: 1.303) .

  • Chemokine CCL5 (RANTES): Molecular modeling suggests that CCL5 interacts with GPR75 at a site distinct from 20-HETE, specifically at the extracellular face between the first and seventh transmembranes . This spatial separation suggests the possibility of ligand-specific signaling cascades through the same receptor.

Functional assays using the PRESTO-Tango system have demonstrated that 20-HETE stimulates β-arrestin2 recruitment following GPR75 activation with an EC50 of 3μM , providing a quantitative measure of receptor activity.

What expression patterns does GPR75 exhibit across mouse tissues?

The expression profile of GPR75 provides important context for understanding its physiological roles. Current evidence indicates:

  • Neural expression: Using RNAscope® technology, GPR75 puncta have been identified in Rbfox3/NeuN positive cells in the hippocampus, confirming expression in hippocampal neurons .

  • Metabolic tissues: Recent reports suggest GPR75 plays roles in regulating insulin secretion and obesity , implying expression in pancreatic islets and potentially adipose tissue, though detailed expression mapping in these tissues requires further investigation.

This tissue distribution pattern aligns with the emerging understanding of GPR75's dual roles in neuronal function and metabolic regulation. Researchers investigating GPR75 should consider this expression pattern when designing tissue-specific experiments or interpreting phenotypic effects in knockout models.

How does the activation mechanism of GPR75 differ from canonical Class A GPCRs?

GPR75 exhibits several structural and functional peculiarities that distinguish its activation mechanism from typical Class A GPCRs:

  • Non-conserved motifs: Key conserved motifs found in most Class A GPCRs are not preserved in GPR75, suggesting a specialized conformational allosteric modulation mechanism . This structural divergence may explain unique signaling properties of this receptor.

  • Absence of proline-induced kink: The substitution of the highly conserved P5.50 with C214 in GPR75 eliminates the characteristic local unwinding of TM5 typically seen in Class A GPCRs. This results in a more straight and rigid TM5 conformation with potentially reduced flexibility in response to ligand binding .

  • Active-state stabilization: Interestingly, GPR75 can adopt an active-like conformation even without ligand binding when stabilized by an intracellular nanobody (NbH3) . This behavior contrasts with the energy landscape theory that suggests apo receptors typically prefer inactive states .

These distinctive features suggest GPR75 may employ non-canonical mechanisms for signal transduction, with important implications for drug discovery efforts targeting this receptor.

What methodological approaches are most effective for studying recombinant GPR75 activation?

Several complementary approaches have proven effective for investigating GPR75 activation:

  • PRESTO-Tango functional assay: This system quantifies ligand-dependent β-arrestin2 recruitment following receptor activation. Initial studies with this approach demonstrated 20-HETE-induced β-arrestin2 recruitment with an EC50 of 3μM .

  • Computational docking analysis: In silico approaches have successfully identified potential ligand binding sites on GPR75, with independent analyses placing 20-HETE in close proximity to a putative binding pocket (Docking Score: −3.229, Glide Emodel: −29.045) .

  • Structural biology: Cryo-EM has been successfully employed to determine the structure of human GPR75 with a stabilizing nanobody at 3.6 Å resolution . This approach revealed key insights into the active-like conformation of the receptor.

  • Nanobody development: The generation of receptor-specific nanobodies using yeast surface display systems provides valuable tools for stabilizing specific receptor conformations for both structural and functional studies .

For optimal results, researchers should consider combining these approaches to develop a comprehensive understanding of GPR75 activation mechanisms.

What are the critical considerations when designing GPR75 knockout models?

The development and validation of GPR75 knockout models require careful attention to several methodological considerations:

  • Validation strategy: A multi-level validation approach is essential, including:

    • Genetic confirmation of target deletion

    • Transcript absence verification using RNAscope or RT-PCR

    • Protein elimination confirmation via Western blotting or immunohistochemistry

    • Functional validation showing altered responses to known ligands (20-HETE, CCL5)

  • Tissue-specific effects: Given GPR75's expression in both neural and metabolic tissues, comprehensive phenotyping should examine multiple systems, including:

    • Neurological function, particularly hippocampal-dependent behaviors

    • Cardiovascular parameters, given the receptor's role in 20-HETE signaling and ACE regulation

    • Metabolic outcomes, including glucose homeostasis and obesity susceptibility

  • Genetic background considerations: The choice of background strain can significantly impact phenotypic manifestations in knockout models. Consider using multiple independent knockout lines or backcrossing to different backgrounds to distinguish receptor-specific effects from strain-dependent modifiers.

  • Developmental compensation: As with many receptor knockouts, compensatory mechanisms may mask phenotypes. Consider inducible knockout strategies or acute pharmacological inhibition approaches to complement constitutive knockout studies.

What expression systems are optimal for producing functional recombinant mouse GPR75?

The choice of expression system significantly impacts the yield, functionality, and experimental utility of recombinant GPR75:

  • Mammalian expression systems:

    • The pCMV6-Entry vector system has been successfully used for mouse GPR75 expression, with neomycin selection in mammalian cells

    • This system produces Myc-DDK-tagged GPR75, facilitating detection and purification

    • Mammalian systems generally provide appropriate post-translational modifications and membrane targeting

  • Truncation considerations:

    • For structural studies, a truncated human GPR75 (residues 1-395) has been successfully employed

    • Truncation may enhance protein stability and crystallization/Cryo-EM suitability

    • Researchers must verify that truncated constructs retain relevant functional properties

  • Fusion partners for functional assays:

    • The PRESTO-Tango system utilizes a GPR75-Tango construct to enable quantification of β-arrestin2 recruitment

    • Such fusion systems provide convenient readouts but require validation to ensure the fusion does not alter receptor pharmacology

When selecting an expression system, researchers should prioritize the specific experimental requirements (high yield, native conformation, functional activity, or ease of detection) and validate that the recombinant receptor retains appropriate ligand binding and signaling properties.

How can researchers resolve conflicting data about GPR75 signaling pathways?

When faced with contradictory findings regarding GPR75 signaling, consider these methodological approaches:

  • Ligand-specific effects: The dual ligands of GPR75 (20-HETE and CCL5) bind at distinct sites and may activate different signaling pathways. Comprehensive studies should:

    • Test multiple ligands at various concentrations

    • Measure multiple signaling outputs (G-protein coupling, β-arrestin recruitment, second messengers)

    • Consider the possibility of biased agonism

  • Cell type context: GPR75 signaling may be influenced by the cellular environment. Compare results across:

    • Recombinant overexpression systems

    • Native cell types expressing endogenous GPR75

    • Primary cells versus cell lines

  • Receptor conformational states: The observation that GPR75 can adopt an active-like state even without ligand binding suggests complex conformational dynamics. Consider:

    • Using conformation-specific nanobodies or antibodies to stabilize specific states

    • Employing receptor mutations to lock the receptor in particular conformations

    • Measuring receptor activity across a temporal continuum to capture transient states

  • Direct comparison studies: Design experiments that directly test contradictory findings under identical conditions, ideally in collaboration with research groups reporting disparate results.

What is the most reliable functional assay for measuring GPR75 activity in response to 20-HETE?

Based on current research, the PRESTO-Tango system represents a well-validated approach for quantifying GPR75 activation:

  • System characteristics:

    • Measures ligand-dependent β-arrestin2 recruitment

    • Has demonstrated robust signal detection with 20-HETE stimulation

    • Provides quantitative readout with an established EC50 value (3μM for 20-HETE)

  • Assay optimization considerations:

    • Time course: Determine optimal measurement windows for capturing peak responses

    • Dose-response relationship: Test wide concentration ranges to establish full pharmacological profiles

    • Controls: Include positive controls (known GPR75 activators) and negative controls (structurally related but inactive compounds)

  • Complementary assays:

    • G-protein coupling assays (GTPγS binding, BRET-based G-protein activation)

    • Second messenger assays (cAMP, calcium mobilization)

    • Receptor internalization measurements

For comprehensive characterization, researchers should employ multiple, complementary assay systems that capture different aspects of receptor function rather than relying on a single readout.

How should researchers approach the analysis of GPR75's role in hippocampal function?

The confirmed expression of GPR75 in hippocampal neurons warrants rigorous investigation of its neurobiological functions:

  • Experimental models:

    • GPR75 knockout mice provide a valuable tool for investigating receptor function in vivo

    • Consider developing conditional knockout models with hippocampus-specific deletion

    • Acute pharmacological manipulation can complement genetic approaches

  • Analytical approaches:

    • Histological analysis of hippocampal structure in GPR75-deficient models

    • Proteomic profiling to identify molecular pathways affected by GPR75 deletion

    • Behavioral assessment focusing on hippocampal-dependent tasks

  • Electrophysiological investigations:

    • Field potential recordings to assess network properties

    • Patch-clamp studies of individual neurons to examine cell-autonomous effects

    • Long-term potentiation/depression protocols to evaluate synaptic plasticity

  • Molecular characterization:

    • RNAscope to map GPR75 expression across hippocampal subregions and cell types

    • Single-cell RNA sequencing to identify cell populations co-expressing GPR75 and its potential signaling partners

    • Phosphoproteomic analysis to identify signaling pathways activated following GPR75 stimulation

This multi-modal approach will provide comprehensive insights into GPR75's functional role in hippocampal circuits and behavior.

What are the main technical challenges in developing selective pharmacological tools for GPR75?

The development of selective modulators for GPR75 faces several obstacles:

  • Structural uniqueness: The non-conserved motifs and unique structural features of GPR75 compared to canonical Class A GPCRs may require novel pharmacophore models for rational drug design.

  • Multiple binding sites: The presence of distinct binding sites for different ligands (20-HETE and CCL5) complicates the development of competitive antagonists and necessitates careful characterization of binding site selectivity.

  • Endogenous ligand properties: 20-HETE is a lipid mediator with complex pharmacology beyond GPR75. Developing selective tools requires:

    • Detailed structure-activity relationship studies

    • Medicinal chemistry optimization to enhance selectivity

    • Comprehensive cross-screening against related receptors

  • Assay considerations: The optimal assay system for compound screening should reflect the most physiologically relevant signaling pathway, which requires further clarification for GPR75.

How does the interplay between 20-HETE signaling and CCL5 binding affect GPR75 function?

The dual-ligand nature of GPR75 raises intriguing questions about potential signaling interactions:

  • Competitive vs. allosteric interactions: Given that 20-HETE and CCL5 appear to bind at distinct sites , researchers should investigate:

    • Whether binding of one ligand affects affinity or efficacy of the other

    • Potential for allosteric modulation between binding sites

    • Signaling consequences of simultaneous vs. sequential exposure to both ligands

  • Biased signaling profiles: Different ligands binding to the same GPCR can activate distinct signaling pathways. Studies should:

    • Compare G-protein coupling profiles induced by each ligand

    • Measure β-arrestin recruitment kinetics and patterns

    • Assess downstream signaling pathway activation

  • Physiological context: The relative importance of each ligand may vary by tissue:

    • 20-HETE may predominate in cardiovascular contexts

    • CCL5 might be more relevant in inflammatory or immune settings

    • The balance between these signaling modes may be dynamically regulated

Understanding this complex pharmacology will be essential for developing targeted therapeutic strategies.

What is the potential significance of GPR75 as a therapeutic target for metabolic disorders?

Recent findings suggesting GPR75's role in regulating insulin secretion and obesity highlight its potential as a therapeutic target:

  • Target validation priorities:

    • Confirm metabolic phenotypes in independent GPR75 knockout models

    • Identify the specific cells/tissues where GPR75 exerts its metabolic effects

    • Determine which endogenous ligand mediates these effects

  • Therapeutic hypothesis development:

    • Based on knockout phenotypes, determine whether agonism or antagonism would be beneficial

    • Consider potential for tissue-selective targeting to minimize off-target effects

    • Evaluate potential advantages over existing metabolic disorder therapies

  • Translational considerations:

    • Assess conservation of metabolic functions between mouse and human GPR75

    • Identify appropriate biomarkers for clinical development

    • Consider potential safety concerns based on GPR75's multiple physiological roles

The dual involvement of GPR75 in both cardiovascular and metabolic regulation presents both challenges and opportunities for therapeutic development, potentially allowing for multi-indication targeting.

What validated vectors and constructs are available for recombinant mouse GPR75 expression?

Several validated expression systems for recombinant mouse GPR75 have been described:

  • Commercial expression plasmids:

    • pCMV6-Entry vector containing mouse GPR75 with C-terminal Myc-DDK tags (SKU: MR220478)

    • Features kanamycin resistance (25 μg/mL) for E. coli selection and neomycin resistance for mammalian cell selection

    • Contains the full ORF sequence representing NM_175490

  • Functional assay constructs:

    • GPR75-Tango construct for the PRESTO-Tango β-arrestin recruitment assay

    • Allows quantification of ligand-dependent receptor activation

  • Structural biology constructs:

    • Truncated GPR75 (residues 1-395) has been successfully used for Cryo-EM studies

    • May provide enhanced stability for biophysical and structural analyses

When selecting a construct, researchers should consider the specific experimental requirements and validate that the recombinant receptor retains appropriate pharmacological properties.

Vector SystemTagsSelection MarkersApplicationsReference
pCMV6-EntryC-terminal Myc-DDKKanamycin (E. coli), Neomycin (mammalian)Expression studies, protein detection
GPR75-TangoTango system componentsNot specifiedβ-arrestin recruitment assays
Truncated (1-395)Not specifiedNot specifiedStructural studies

What knockout validation methods ensure complete functional elimination of GPR75?

Comprehensive validation of GPR75 knockout models requires multi-level confirmation:

  • Genetic validation:

    • PCR-based genotyping to confirm deletion of target sequences

    • Sequencing to verify precise modification at the genomic level

  • Transcript verification:

    • RNAscope® for spatial verification of transcript elimination in relevant tissues

    • RT-PCR or RNA-seq to confirm absence of full-length and potential splice variant transcripts

  • Protein elimination:

    • Western blotting with validated antibodies

    • Immunohistochemistry in tissues known to express GPR75

  • Functional validation:

    • Demonstration of lost responses to known GPR75 ligands (20-HETE, CCL5)

    • Phenotypic characterization focusing on systems where GPR75 has established roles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.