Recombinant Mouse Probable G-protein coupled receptor 88 (Gpr88)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purification

Recombinant Gpr88 is typically produced using:

  • E. coli: Full-length human GPR88 (1-384 aa) with N-terminal His tags achieves >90% purity .

  • Cell-free synthesis: Mouse Gpr88 (AA 1-384) with Strep tags achieves >70% purity, validated via SDS-PAGE and Western blot .

Comparative Expression Data

Host SystemTagPurityApplication
E. coliHis>90%Structural studies
CFPS*Strep>70%Functional assays

*Cell-free protein synthesis

Functional Roles in Signaling

Gpr88 modulates striatal GPCR networks through two mechanisms:

  • G protein inhibition: Reduces cAMP production by opioid receptors (µOR, δOR, κOR) and dopamine receptors via physical proximity .

  • β-arrestin bias: Impedes β-arrestin recruitment across GPCRs, independent of proximity .

In Vitro Findings

  • Co-expression with µOR decreases morphine-induced GTPγS binding by 40% .

  • Agonists like RTI-13951-33 show nanomolar potency (EC<sub>50</sub> = 25 nM) in cAMP assays .

Behavioral and Therapeutic Implications

Knockout Mouse Phenotypes

BehaviorObservation in Gpr88<sup>-/-</sup> MiceRelevance to Disease
Morphine analgesiaEnhanced supraspinal analgesiaPain management
Alcohol consumptionRTI-13951-33 reduces intake by 50%Addiction therapy
Motor coordinationHyperactivity in novel environmentsParkinson’s disease

Therapeutic Targets

  • Parkinson’s disease: Gpr88 activation may compensate for dopamine receptor dysregulation .

  • Alcohol use disorder: RTI-13951-33 reduces voluntary drinking without affecting water intake .

Research Tools and Limitations

  • Agonists: (1R,2R)-2-PCCA and RTI-13951-33 serve as allosteric modulators .

  • Challenges: Lack of confirmed endogenous ligands and species-specific signaling differences (e.g., human vs. mouse Q204<sup>5.50</sup>) .

Future Directions

  • Ligand discovery: High-throughput screens using recombinant Gpr88 to identify orthosteric agonists .

  • Structural optimization: Engineering thermostable mutants for crystallography .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr88; Strg; Probable G-protein coupled receptor 88; Striatum-specific G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPSGSAEPPGDWDGGGGSYRLLRGGLL GLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTVGMLALSWALALGLVLLLPPWA PKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC AAAAAAFPAAPHAPGPGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPL VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA AAAATAVPAMSQAQLGTRAAGQHW
Uniprot No.

Target Background

Function
Probable G-protein coupled receptor implicated in a wide range of behavioral responses involving motor activity, spatial learning, and emotional processing. It may play a role in regulating cognitive and motor function.
Gene References Into Functions
  1. GPR88 in A2A receptor-expressing neurons modulates psychomotor behavior but not sensorimotor gating. PMID: 28700108
  2. GPR88 activity influences the mouse brain's functional and structural connectome PMID: 28882062
  3. Analysis of Gpr88-adenosine A2AR-Cre transgenic mice reveals that GPR88 in adenosine A2AR medium spiny neurons regulates locomotor and anxiety behaviors. PMID: 27570825
  4. GPR88 expression in the corpus striatum is crucial for efficient integration of effort and choice behavior. PMID: 28729439
  5. Results indicate that GPR88 is involved in a broad spectrum of behavioral responses engaging motor activity, spatial learning, and emotional processing, and reveals functional antagonism between GPR88 and delta opioid receptor activities in vivo PMID: 26188600
  6. This study demonstrated that a lack of GPR88 enhances medium spiny neuron activity and alters motor- and cue-dependent behaviors PMID: 23064379
  7. The modulatory role of Gpr88 in striatal dopamine function suggests it may be a novel target for treatments of psychiatric disorders. PMID: 19796684

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Nucleus.
Tissue Specificity
Expressed predominantly in the striatum.

Q&A

What is GPR88 and where is it primarily expressed?

GPR88 is an orphan G-protein-coupled receptor with predominant expression in reward-related areas in the brain. It is highly enriched in the striatum and cortex of rodents and humans, with particularly strong expression in both striatonigral (D1R-expressing) and striatopallidal (D2R-expressing) medium spiny neurons . This receptor is considered Gi/o-coupled based on current evidence and shows distinct expression patterns during development and in the adult brain . Methodologically, researchers typically use in situ hybridization and immunohistochemistry techniques to characterize its expression patterns across brain regions.

Why is GPR88 considered an important target for neuropsychiatric research?

GPR88 has emerged as a promising target due to multiple lines of evidence across species. In humans, genetic studies have found positive associations between GPR88 and several psychiatric conditions including bipolar disorder, schizophrenia, childhood chorea, learning disabilities, and speech retardation . In rodent models, GPR88 knockout studies have revealed phenotypes relevant to multiple neuropsychiatric conditions including altered motor control, anxiety, impulsivity, and addiction-related behaviors . The receptor's strategic location in key brain circuits controlling reward, motor function, and emotional processing makes it particularly relevant for investigating mechanisms underlying disorders like alcohol use disorder (AUD), anxiety disorders, and movement disorders .

What are the primary research approaches used to study GPR88 function?

Research approaches for studying GPR88 function fall into several methodological categories:

  • Genetic approaches: Including constitutive knockout mice, conditional (cell-type specific) knockouts (e.g., A2AR-Gpr88KO), and human genetic association studies .

  • Pharmacological approaches: Development and testing of selective GPR88 agonists like RTI-13951-33 and 2-PCCA, with complementary behavioral and molecular readouts .

  • Molecular and cellular approaches: Including TRAP (Translating Ribosome Affinity Purification) for cell-type-specific translatome analysis, radioligand binding assays, and electrophysiological studies of neuronal excitability .

  • Behavioral approaches: Assessing phenotypes related to motor function, reward processing, anxiety, and addiction across different experimental paradigms like intermittent-access-two-bottle-choice for alcohol consumption .

How are GPR88 knockout mouse models generated and validated?

GPR88 knockout mouse models are typically generated using Cre-loxP recombination technology. In constitutive GPR88 knockout models, exon 2 of the Gpr88 gene is targeted for deletion by flanking it with loxP sites (upstream) and a Lox-FRT neomycin-resistance cassette (downstream) . These mice are then crossed with CMV-Cre mice expressing Cre recombinase under the cytomegalovirus promoter, leading to germline deletion of Gpr88 exon 2.

For conditional knockouts, such as the A2AR-Gpr88KO mice, floxed Gpr88 mice are crossed with Cre lines expressing Cre recombinase under promoters active in specific neuronal populations (e.g., adenosine A2A receptor-expressing neurons) . Validation typically involves:

  • Genotyping using PCR to confirm the deletion

  • mRNA quantification via qPCR or in situ hybridization to verify reduced expression in targeted tissues

  • Immunohistochemistry to confirm protein reduction

  • Functional validation through electrophysiology or known behavioral phenotypes

For instance, A2AR-Gpr88KO mice show selective reduction of Gpr88 mRNA in D2R-expressing neurons but not D1R-expressing neurons, confirming the specificity of the conditional approach .

What pharmacological tools are available for studying GPR88?

Recent advances have yielded several pharmacological tools for GPR88 research:

CompoundTypePotencyBrain PenetrationExperimental Applications
RTI-13951-33AgonistEC50 = 25 nMGood (brain Cmax/plasma Cmax ratio)In vivo behavioral studies, alcohol drinking reduction
2-PCCAAgonistHigher EC50 than RTI-13951-33LimitedIn vitro assays primarily
[3H]RTI-33RadioligandKD of 85 nMNot applicableBinding assays, receptor characterization

RTI-13951-33 represents a significant advance as it shows nanomolar potency at the recombinant receptor using in vitro cAMP assays and efficiently stimulates GPR88-mediated G protein activity in striatal membranes prepared from control but not Gpr88 knockout mice . The compound's high water solubility and favorable pharmacokinetic properties make it suitable for animal behavioral studies .

The radioligand [3H]RTI-33, derived from RTI-13951-33, has a specific activity of 83.4 Ci/mmol and shows one-site, saturable binding with a KD of 85 nM in membranes prepared from stable PPLS-HA-hGPR88-CHO cells . This radioligand enables competition binding assays to determine binding affinities of GPR88 ligands.

How can researchers implement TRAP technology to study GPR88 in specific neuronal populations?

Translating Ribosome Affinity Purification (TRAP) is a powerful technique for studying cell-type-specific translatomes, including GPR88-expressing neurons. The methodological approach involves:

  • Generation of TRAP mice: Crossing Rosa26fsTRAP mice with cell-type-specific Cre lines (e.g., Nav1.8cre) to generate mice expressing a fused eGFP-L10a protein in specific neurons .

  • Tissue processing: Harvesting relevant tissues (e.g., dorsal root ganglia for pain studies) and preparing lysates under conditions that preserve polysomes.

  • Affinity purification: Using anti-GFP antibodies to isolate ribosome-mRNA complexes specifically from the cell type of interest.

  • RNA-seq analysis: Sequencing the purified mRNA to analyze the translatome and identify differentially translated genes (e.g., upregulation of Gpr88 in specific conditions).

This approach has successfully identified Gpr88 as an upregulated gene in certain pain conditions, demonstrating its utility for understanding cell-type-specific translation dynamics . Researchers can adapt this approach to study GPR88 translation in striatal neurons by using appropriate Cre driver lines (e.g., D1R-Cre or D2R-Cre).

What is the role of GPR88 in alcohol use disorders and addiction?

GPR88 plays a significant role in alcohol-related behaviors as evidenced by multiple experimental approaches:

  • Knockout studies: Gpr88 knockout animals show increased voluntary alcohol drinking at both moderate and excessive levels and increased alcohol-seeking behavior . This suggests GPR88 normally functions to limit alcohol consumption.

  • Pharmacological studies: The GPR88 agonist RTI-13951-33 reduces excessive voluntary alcohol drinking in the intermittent-access-two-bottle-choice paradigm while sparing water consumption. This effect was observed in C57BL/6 control mice but not in Gpr88 knockout mice, confirming target specificity .

  • Neuroimaging evidence: Magnetic resonance imaging of Gpr88 knockout mice revealed remodeling of executive, reward and emotional networks involved in substance use disorders, including alcohol use disorder (AUD) .

Mechanistically, GPR88 appears to modulate striatal function critical for reward processing and habit formation. The agonist RTI-13951-33 represents a promising lead compound for potential therapeutic development in AUD, with preclinical evidence supporting its efficacy in reducing alcohol consumption through a GPR88-dependent mechanism .

How does GPR88 influence metabolic regulation and energy homeostasis?

GPR88 unexpectedly plays a significant role in energy homeostasis, extending its functions beyond the traditional focus on neuropsychiatric processes:

  • Adiposity regulation: Gpr88−/− mice show significantly reduced adiposity accompanied with suppressed spontaneous food intake, particularly pronounced under high fat diet (HFD) treatment .

  • Glucose metabolism: Deregulation in glucose tolerance and insulin responsiveness in response to HFD is attenuated in Gpr88−/− mice, suggesting a protective effect against metabolic syndrome features .

  • Hypothalamic signaling: At the molecular level, GPR88 deficiency is associated with distinct changes in hypothalamic mRNA levels of cocaine-and amphetamine-regulated transcript (Cartpt), along with altered expressions of the anorectic Pomc and the orexigenic Npy in the arcuate nucleus, especially under HFD conditions .

These findings expand GPR88's functional profile beyond addiction and motor control to include central regulatory circuits for energy homeostasis. The receptor appears to influence both reward aspects of feeding behavior and hypothalamic regulation of energy balance, positioning it as a potential integrator of reward and metabolic functions .

What is known about GPR88's role in anxiety and fear responses?

GPR88 exerts significant control over anxiety-like behaviors through specific neuronal populations:

  • Anxiogenic effects: GPR88 expressed in A2AR neurons (predominantly D2R-expressing striatopallidal neurons) enhances ethological anxiety-like behaviors. Both total Gpr88KO mice and A2AR-Gpr88KO mice show decreased anxiety-like behaviors in light/dark and elevated plus maze tests .

  • Population-specific effects: While the anxiogenic effect is mediated through A2AR neurons, other behavioral effects show different neural substrates. A2AR-Gpr88KO mice showed no change in novelty preference and novelty-suppressed feeding, while these responses were altered in total Gpr88KO mice .

  • Fear conditioning: GPR88 activity regulates conditional fear, but this effect is not mediated by receptors in A2AR neurons. A2AR-Gpr88KO mice showed intact fear conditioning, while fear responses were decreased in total Gpr88KO mice .

This dissociation between anxiety subtypes suggests GPR88 acts through multiple circuit mechanisms to regulate emotional behaviors. Methodologically, these findings were established using specific behavioral paradigms that distinguish between different types of anxiety-like behaviors (ethological versus conflict anxiety) and fear conditioning .

What is the role of GPR88 in pain processing and hyperalgesic priming?

Recent research has identified GPR88 as a significant player in persistent pain states:

  • Upregulation in pain states: TRAP sequencing analysis has identified Gpr88 as upregulated in nociceptor (pain-sensing) neurons during hyperalgesic priming, a model of transition from acute to chronic pain .

  • Functional consequences: Pharmacological studies show that a GPR88 agonist causes pain only in primed mice (mice that have undergone the transition to a persistent pain-sensitized state), suggesting that upregulation of GPR88 contributes to pain hypersensitivity .

  • Therapeutic implications: This finding positions GPR88 as a potential target for chronic pain conditions, especially those involving neural plasticity and sensitization.

Methodologically, these findings were established using a combination of cell-type-specific translatomic analysis (TRAP-seq) and behavioral pharmacology in mouse models of hyperalgesic priming .

How does the GPR88 agonist RTI-13951-33 affect alcohol-related behaviors?

RTI-13951-33 demonstrates promising effects on alcohol-related behaviors with the following characteristics:

  • Efficacy: In the intermittent-access-two-bottle-choice paradigm, RTI-13951-33 significantly reduces excessive voluntary alcohol drinking while sparing water consumption, indicating specific effects on alcohol reward rather than general fluid intake .

  • Target specificity: The compound's effects on alcohol consumption are observed in wild-type C57BL/6 mice but not in Gpr88 knockout mice, confirming that the behavioral effects are mediated specifically through GPR88 rather than off-target actions .

  • Pharmacological properties: RTI-13951-33 shows nanomolar potency (EC50 = 25 nM) at the recombinant receptor using an in vitro cAMP assay. It efficiently stimulates GPR88-mediated G protein activity in striatal membranes and has favorable brain penetration and pharmacokinetic properties for behavioral studies .

This pharmacological evidence positions RTI-13951-33 as a promising lead compound for evaluating GPR88 as a therapeutic target for alcohol use disorders. The compound's selectivity and efficacy make it a valuable tool for further preclinical studies examining GPR88 function in addiction and other neuropsychiatric conditions .

What methods are used to characterize novel GPR88 ligands?

Characterization of novel GPR88 ligands involves a comprehensive pipeline of techniques:

  • In vitro pharmacology:

    • cAMP assays using recombinant cell lines expressing GPR88 to determine potency (EC50 values)

    • G-protein activation assays in native tissue (e.g., [35S]GTPγS binding in striatal membranes)

    • Radioligand binding assays using [3H]RTI-33 to determine binding affinity (KD values)

  • Pharmacokinetic assessment:

    • Brain penetration studies to determine brain/plasma ratios

    • Metabolism studies to assess stability

    • Administration route optimization (e.g., intraperitoneal versus oral bioavailability)

  • Target validation in vivo:

    • Parallel testing in wild-type and Gpr88 knockout mice to confirm target specificity

    • Comparison across multiple behavioral paradigms to assess domain specificity of effects

  • Structural studies:

    • Structure-activity relationship (SAR) analyses to identify critical molecular features

    • Optimization of pharmacophores to improve potency, selectivity, and drug-like properties

The development of [3H]RTI-33 as a radioligand with a specific activity of 83.4 Ci/mmol and KD of 85 nM has been particularly significant, as it enables competition binding assays to determine binding affinities of several known GPR88 agonists .

What are the potential therapeutic applications of GPR88-targeting compounds beyond alcohol use disorders?

Based on the diverse physiological roles of GPR88, several therapeutic applications are being explored:

Potential IndicationSupporting EvidenceTherapeutic Approach
Anxiety disordersReduced anxiety-like behaviors in Gpr88 knockout mice GPR88 antagonists could have anxiolytic effects
Chronic painGPR88 upregulation in hyperalgesic priming; GPR88 agonist causes pain in primed states GPR88 antagonists may reduce persistent pain
Metabolic disordersGpr88−/− mice show protection against HFD-induced metabolic disturbances GPR88 modulators might help regulate energy homeostasis
SchizophreniaHuman genetic associations; disrupted sensorimotor gating in knockout mice GPR88 agonists might improve certain symptoms
ADHDHyperactivity and attentional deficits in knockout mice GPR88 agonists could potentially reduce hyperactivity

The diversity of potential applications reflects GPR88's involvement in multiple neural circuits and physiological processes. Development of subtype-selective compounds or tissue-targeted delivery approaches might help optimize therapeutic efficacy while minimizing side effects across these different indications .

How might the developmental versus acute roles of GPR88 be distinguished experimentally?

Distinguishing between developmental versus acute roles of GPR88 requires sophisticated experimental approaches:

  • Temporal control of gene expression:

    • Inducible knockout systems (e.g., tamoxifen-inducible CreERT2) allow deletion of Gpr88 at different developmental stages or in adulthood

    • Viral-mediated knockdown or overexpression in adult animals circumvents developmental compensations

    • Comparing phenotypes between constitutive and adult-induced knockouts can reveal developmental contributions

  • Pharmacological approaches:

    • Acute administration of selective agonists like RTI-13951-33 reveals the consequences of receptor activation independent of developmental roles

    • Comparing pharmacological effects to genetic models helps distinguish acute signaling from developmental functions

  • Circuit-specific manipulations:

    • Combining conditional knockouts with circuit-specific manipulations (optogenetics, chemogenetics) can reveal how GPR88 acutely modulates specific pathways

    • Ex vivo electrophysiology before and after acute receptor manipulation helps isolate direct effects on neuronal function

Current knowledge of GPR88 roles in the brain is mainly based on constitutive gene knockout studies, which do not distinguish developmental roles from regulatory roles of the receptor in the adult. The development of pharmacological tools like RTI-13951-33 is critical for investigating GPR88's acute function and therapeutic potential separate from developmental effects .

What methodological challenges exist in studying GPR88's interaction with other neurotransmitter systems?

Several methodological challenges complicate the study of GPR88's interactions with other neurotransmitter systems:

  • Cell-type heterogeneity:

    • GPR88 is expressed in both D1R- and D2R-expressing MSNs, which have opposing effects on behavior

    • Determining pathway-specific effects requires sophisticated cell-type-specific approaches like conditional knockouts, TRAP-seq, or single-cell analyses

  • Orphan receptor status:

    • The endogenous ligand for GPR88 remains unknown, complicating studies of physiological activation

    • Understanding when and how GPR88 is naturally activated in vivo remains challenging

  • Complex signaling integration:

    • GPR88 likely modulates multiple neurotransmitter systems including dopamine, glutamate, and GABA

    • Disentangling direct from indirect effects requires combination approaches like microdialysis with receptor-specific manipulations

  • Temporal dynamics:

    • Acute versus chronic adaptations in signaling networks can produce opposing effects

    • Studies must address different time scales from immediate signaling to long-term adaptations

Advanced approaches to address these challenges include:

  • Multiplexed FISH to simultaneously visualize GPR88 with multiple receptor markers

  • In vivo calcium imaging combined with receptor manipulation to capture real-time circuit dynamics

  • Computational modeling to predict complex interactions across neurotransmitter systems

How can translational relevance of GPR88 findings be enhanced for human applications?

Enhancing translational relevance of GPR88 research requires bridging animal models with human applications:

  • Human genetic and postmortem studies:

    • Expanded screening for GPR88 variants in human populations with relevant disorders

    • Analysis of GPR88 expression in postmortem tissue from patients with psychiatric disorders

    • Integration of human genetic data with animal model phenotypes to identify convergent mechanisms

  • Improved animal models:

    • Development of more sophisticated models that better recapitulate human disease features

    • Inclusion of both sexes and consideration of age-dependent effects to match clinical heterogeneity

    • Cross-species validation in multiple rodent models and potentially non-human primates

  • Translational biomarkers:

    • Identification of GPR88-associated biomarkers that can be measured across species

    • Development of PET ligands for GPR88 to enable human imaging studies

    • Correlation of pharmacological effects with quantifiable biomarkers rather than just behavioral outcomes

  • Pharmacological optimization:

    • Medicinal chemistry efforts to improve drug-like properties of compounds like RTI-13951-33

    • Careful assessment of off-target effects and safety profiles

    • Development of biased ligands that selectively activate beneficial signaling pathways

The combination of human genetic evidence, consistent phenotypes across multiple species and models, and development of clinically viable pharmacological tools will be crucial for successful translation of GPR88 research to human therapeutics .

What are the most promising future directions for GPR88 research?

Several promising research directions emerge from current GPR88 knowledge:

  • Discovery of endogenous ligands: Identifying the natural ligand(s) for this orphan receptor would significantly advance understanding of its physiological roles and regulation.

  • Circuit-specific functions: Further delineation of GPR88's role in specific neural circuits using conditional approaches will help clarify its contribution to different behavioral domains.

  • Therapeutic development: Optimization of compounds like RTI-13951-33 for clinical development, particularly for alcohol use disorders where preclinical evidence is strongest.

  • Expanded disease models: Investigation of GPR88 in additional disease contexts including chronic pain, metabolic disorders, and other addiction-related conditions.

  • Integration across physiological systems: Further exploration of GPR88's unexpected role in metabolic regulation and its potential integration of reward and energy homeostasis functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.