Recombinant Mouse Probable glutathione peroxidase 8 (Gpx8)

Shipped with Ice Packs
In Stock

Description

Functional Roles

  • Oxidative Stress and Protein Folding Gpx8 can increase the protein disulfide-isomerase (PDI) activity of ERO1, which promotes oxidative folding of endoplasmic reticulum proteins, and reduces oxidative stress .

  • Calcium Regulation Gpx8 is enriched in mitochondria-associated membranes (MAMs), a critical integrating center for calcium, lipid metabolism, and redox signaling homeostasis . Overexpression of GPX8 leads to a decrease in $$Ca^{2+}$$ levels in the endoplasmic reticulum, while silencing GPX8 increases the histamine-induced release of $$Ca^{2+}$$ from the endoplasmic reticulum to mitochondria and cytoplasm . The TMD of GPX8 plays a key role in the regulation of $$Ca^{2+}$$ signaling, possibly related to the inositol 1,4,5-triphosphate receptor (IP3R) effect .

  • Tumor Aggressiveness Gpx8 regulates cancer aggressiveness . GPX8 expression was induced by the epithelial–mesenchymal transition (EMT) program. GPX8 expression significantly correlated with known mesenchymal markers and poor prognosis in breast cancer patients . Lack of GPX8 suppresses the aggressive phenotype and stemness features of tumor cells .

  • Metastasis Highly expressed GPX8 in lung cancer cells and fibroblasts functions as a pro-metastatic factor in lung cancer . Knockdown of GPX8 inhibited LUAD metastasis in vitro and in vivo, while it did not obviously affect tumor growth . Knockdown of GPX8 decreased the levels of p-FAK and p-Paxillin and disturbed the distribution of focal adhesion .

  • Immune Defense GPx8 acts as an oxidative stress sensor that protects against colitis by negatively regulating caspase-4/11 activity .

GPX8 and Cancer

GPX8 plays a role in maintaining cancer cells at an aggressive state via regulation of the IL-6/JAK/STAT3 signaling pathway .

Regulation of the Non-Canonical Inflammasome Pathway

GPx8 modulates the non-canonical inflammasome pathway . GPx8 deficiency enhances caspase-11 activation and pyroptotic cell death .

Expression Analysis

GPX8 expression correlates with a significant reduction in patient outcome .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
Gpx8; Probable glutathione peroxidase 8; GPx-8; GSHPx-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPFAAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRTNSFYSFEVKDAKGRTV SLEKFKGKASLVVNVASDCRFTDKSYQTLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK EVESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEPRWNFWKYLVNPEGQVVKF WRPEEPLEAIRPHVSQMIGQIILKKKEDL
Uniprot No.

Target Background

Database Links
Protein Families
Glutathione peroxidase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of mouse Gpx8?

Mouse Gpx8 is a type II transmembrane protein consisting of 209 amino acids, structurally similar to GPX7. It contains an N-terminal transmembrane domain (TMD) that plays a key role in its localization and function. Unlike some other GPX family members, GPX8 has relatively low glutathione peroxidase (GSH) activity, primarily due to the lack of domains bound to GSH . Its main functions include participation in oxidative protein folding in the endoplasmic reticulum (ER), reduction of oxidative stress, and regulation of calcium signaling through potential interactions with inositol 1,4,5-triphosphate receptor (IP3R) .

How does mouse Gpx8 differ from other members of the glutathione peroxidase family?

Mouse Gpx8 differs from other GPX family members in several key aspects. While GPX1-4 and GPX6 use selenocysteine as their active center to catalyze the reduction of hydrogen peroxide, GPX8 has low glutathione peroxidase activity . Unlike GPX7, which contains a C-terminal KEDL endoplasmic reticulum localization sequence, GPX8 is a transmembrane protein with a highly conserved N-terminal transmembrane domain . This structural difference influences its subcellular localization and function. GPX8 is particularly enriched in mitochondria-associated membranes (MAMs), which are critical integrating centers for calcium, lipid metabolism, and redox signaling homeostasis .

What are the primary cellular locations where mouse Gpx8 is expressed?

Mouse Gpx8 is primarily localized in the endoplasmic reticulum (ER) membrane due to its transmembrane domain structure. It is particularly enriched in mitochondria-associated membranes (MAMs), which are contact sites between the ER and mitochondria . These specialized membrane domains are critical for calcium signaling, lipid transfer, and coordination of various cellular functions. The specific localization pattern of Gpx8 in different mouse tissues varies, with expression potentially regulated by physiological conditions including oxidative stress and hypoxia, as GPX8 promoter contains hypoxia-response elements regulated by HIF1α .

What are the recommended methods for expressing recombinant mouse Gpx8 in vitro?

For optimal expression of recombinant mouse Gpx8, researchers should consider:

  • Expression Systems:

    • Mammalian expression systems (HEK293 or CHO cells) are preferred for maintaining proper post-translational modifications

    • For high yield, insect cell systems (Sf9 or High Five) with baculovirus vectors can be effective

  • Vector Design:

    • Include appropriate tags (His, FLAG, or HA) for detection and purification

    • Consider codon optimization for the expression system used

    • Ensure inclusion of the transmembrane domain for proper localization studies

  • Culture Conditions:

    • Maintain cells at 30-37°C depending on the expression system

    • For mammalian cells, reduced serum conditions during protein production may enhance yield

    • Consider inducing oxidative stress conditions to mimic physiological contexts

When purifying the recombinant protein, gentle detergents such as CHAPS or DDM should be used to solubilize the transmembrane domain while maintaining protein structure and function .

What are the most reliable assays for measuring mouse Gpx8 activity?

Given Gpx8's low classical glutathione peroxidase activity, standard GPX activity assays may not be optimal. Instead, researchers should consider:

  • PDI Activity Enhancement Assay:

    • Measure the rate of protein disulfide isomerase (PDI) activity in the presence and absence of Gpx8

    • Use fluorescent substrates that change emission properties upon disulfide bond formation

  • Calcium Flux Measurements:

    • Employ fluorescent calcium indicators (Fura-2, Fluo-4) to measure calcium release from ER in Gpx8-expressing cells

    • Compare histamine-induced calcium release in Gpx8-expressing vs. knockout cells

  • Protein Folding Assessment:

    • Monitor the oxidative folding of ER model proteins in the presence of recombinant Gpx8

    • Use pulse-chase experiments with radioactive or fluorescent labeling

  • H2O2 Consumption Assay:

    • While not as sensitive as for other GPX family members, specialized assays with high sensitivity can detect the low peroxidase activity

How should researchers design knockdown/knockout experiments for mouse Gpx8?

When designing gene silencing experiments for mouse Gpx8, researchers should:

  • CRISPR-Cas9 Strategy:

    • Target conserved exons to ensure complete loss of function

    • Design multiple guide RNAs to increase efficiency

    • Validate knockout by both genomic sequencing and protein expression analysis

  • shRNA/siRNA Approach:

    • Design at least 3-4 different targeting sequences to identify the most effective

    • Include controls for off-target effects

    • Monitor knockdown efficiency by qRT-PCR and western blotting

  • Phenotypic Validation:

    • Assess cell morphology changes (as GPX8 loss can induce epithelial-like phenotypes in mesenchymal cells)

    • Measure calcium flux changes from ER stores

    • Evaluate endoplasmic reticulum stress markers

  • Rescue Experiments:

    • Include restoration of GPX8 expression with constructs containing mutations in PAM and guide recognition sites (for CRISPR knockouts)

    • This approach helps confirm phenotypic changes are specifically due to GPX8 loss

How does mouse Gpx8 function in cancer models and what experimental approaches are most effective?

Mouse Gpx8 has demonstrated significant roles in cancer progression that can be investigated through:

  • Tumor Xenograft Models:

    • Compare tumor initiation and growth rates between Gpx8 wild-type and knockout cells

    • GPX8 knockout in mesenchymal-like breast cancer cells (MDA-MB-231) significantly delayed tumor initiation and decreased growth rate in mice

  • Metastasis Assays:

    • Tail vein injection models to assess lung colonization capacity

    • Knockdown of GPX8 inhibited lung adenocarcinoma metastasis in vivo

    • Monitor both tumor growth and metastatic spread using bioluminescence imaging

  • EMT Assessment:

    • Analyze epithelial-mesenchymal transition markers (E-cadherin, ZEB1, N-cadherin) after Gpx8 modulation

    • GPX8 knockout cells show increased epithelial marker expression and decreased mesenchymal markers

  • Cancer Stemness Evaluation:

    • Sphere formation assays to assess self-renewal capacity

    • Flow cytometry analysis of stemness markers (CD24/CD44 profile)

    • Clonogenic assays to evaluate tumorigenic potential

What is the relationship between mouse Gpx8 and calcium signaling in experimental models?

To investigate Gpx8's role in calcium signaling:

  • Measurement Approaches:

    • Use ratiometric calcium indicators (Fura-2) for quantitative analysis

    • Employ genetically encoded calcium indicators for compartment-specific measurements

    • Perform real-time imaging of calcium flux after histamine stimulation

  • Research Findings:

    • Overexpression of GPX8 reduces calcium storage and histamine-induced calcium release from the endoplasmic reticulum

    • Silencing GPX8 increases histamine-induced calcium release from ER to mitochondria and cytoplasm

    • The transmembrane domain of GPX8 plays a key role in this regulation

  • Experimental Design:

    • Compare calcium dynamics in GPX8 knockout, wild-type, and overexpression models

    • Evaluate interactions with IP3R using co-immunoprecipitation and proximity ligation assays

    • Assess mitochondrial calcium uptake in relation to GPX8 expression levels at MAM sites

How does mouse Gpx8 interact with key signaling pathways in different research models?

Gpx8 interacts with several important signaling pathways that can be studied through:

  • IL-6/STAT3 Signaling:

    • GPX8 knockout in breast cancer cells represses IL-6 production

    • This affects IL-6 trans-signaling mechanisms and JAK/STAT3 pathway activation

    • Measure phosphorylated STAT3 levels by western blotting and immunofluorescence

  • PI3K-AKT Pathway:

    • GPX8 knockdown in hepatocellular carcinoma cells activates the PI3K-AKT pathway

    • This can be monitored through phosphorylated AKT levels

    • Inhibition with MK-2206 (AKT inhibitor) can reverse effects of GPX8 downregulation

  • Hsc70 Interaction:

    • GPX8 directly interacts with 71-kDa heat shock cognate protein (Hsc70)

    • The phosphorylation of AKT promotes Hsc70 nuclear translocation and PI3K p110 subunit expression

    • Study this interaction through co-immunoprecipitation and protein localization assays

  • Focal Adhesion Signaling:

    • GPX8 knockdown decreases levels of phosphorylated FAK and Paxillin

    • This disturbs focal adhesion distribution

    • Visualization can be achieved with immunofluorescence microscopy

How can researchers effectively analyze the interactome of recombinant mouse Gpx8?

To comprehensively characterize the Gpx8 interactome:

  • Proximity-Based Approaches:

    • BioID or TurboID fusion proteins for identifying proximal interacting partners

    • APEX2 labeling for capturing transient interactions in the ER environment

  • Affinity Purification-Mass Spectrometry:

    • Use mild detergents to maintain membrane protein interactions

    • Consider crosslinking approaches to stabilize weak interactions

    • Compare interactomes under normal and stress conditions (oxidative stress, ER stress)

  • FRET/BRET Analysis:

    • For specific candidate interactions, use fluorescence or bioluminescence resonance energy transfer

    • This allows dynamic monitoring of protein-protein interactions in living cells

  • Data Analysis:

    • Apply stringent statistical filters with appropriate controls

    • Use functional enrichment analysis to identify biological processes

    • Validate key interactions through orthogonal methods such as co-immunoprecipitation

What are the best approaches for investigating post-translational modifications of mouse Gpx8?

To study post-translational modifications (PTMs) of Gpx8:

  • Mass Spectrometry Approaches:

    • Employ enrichment techniques for specific PTMs (phosphorylation, glycosylation)

    • Use both bottom-up and top-down proteomics for comprehensive coverage

    • Compare PTM profiles under different cellular conditions

  • Site-Directed Mutagenesis:

    • Create point mutations at predicted modification sites

    • Assess functional consequences of PTM loss

    • Compare wild-type and mutant protein localization and activity

  • PTM-Specific Antibodies:

    • Develop or use commercial antibodies against specific modified forms

    • Employ for western blotting and immunofluorescence microscopy

  • Dynamic PTM Analysis:

    • Pulse-chase experiments to track modification kinetics

    • Assess changes in PTM patterns during oxidative stress or ER stress

How can researchers design experiments to study the role of mouse Gpx8 in redox regulation?

For investigating Gpx8's role in redox regulation:

  • Redox Proteomics:

    • Use differential alkylation approaches (OxICAT, iodoTMT) to identify proteins with altered redox state

    • Compare redox proteomes between wild-type and Gpx8-deficient cells

  • Real-time Redox Sensors:

    • Employ roGFP or HyPer sensors targeted to the ER lumen

    • Monitor dynamic changes in redox state with Gpx8 modulation

    • Assess recovery from induced oxidative stress

  • Protein Folding Analysis:

    • Track disulfide bond formation kinetics of model proteins

    • Compare oxidative folding efficiency in presence or absence of Gpx8

    • Measure PDI activity enhancement by Gpx8

  • ER Stress Response:

    • Monitor UPR pathway activation (PERK, IRE1, ATF6) as indicators of disrupted ER redox homeostasis

    • Assess cell survival under ER stress conditions with varying Gpx8 expression levels

What are common technical challenges when working with recombinant mouse Gpx8 and how can they be addressed?

Researchers commonly encounter these challenges with recombinant Gpx8:

  • Protein Solubility Issues:

    • Challenge: The transmembrane domain makes Gpx8 difficult to solubilize

    • Solution: Optimize detergent selection (CHAPS, DDM, or digitonin) at minimal effective concentrations

    • Alternative: Express truncated versions without the transmembrane domain for specific applications

  • Low Activity Detection:

    • Challenge: Conventional GPX activity assays may not be sensitive enough

    • Solution: Develop custom assays that measure indirect effects such as PDI activity enhancement

    • Alternative: Use surrogate readouts like calcium flux or protein folding efficiency

  • Antibody Specificity:

    • Challenge: Cross-reactivity with other GPX family members

    • Solution: Validate antibodies using knockout/knockdown controls

    • Alternative: Use epitope tags on recombinant proteins for specific detection

  • Cellular Localization Confirmation:

    • Challenge: Confirming proper ER/MAM localization

    • Solution: Use subcellular fractionation combined with marker proteins

    • Alternative: Employ super-resolution microscopy with co-localization analysis

How should researchers interpret contradictory findings about mouse Gpx8 expression and function?

When confronting contradictory findings:

  • Context-Dependent Expression:

    • GPX8 can be upregulated in some cancers (breast cancer, lung cancer) but downregulated in others (hepatocellular carcinoma)

    • Solution: Carefully document tissue type, cancer subtype, and experimental conditions

    • Consider analyzing expression across cancer progression stages

  • Cell-Type Specific Functions:

    • GPX8's effects may vary between epithelial and mesenchymal cells

    • Solution: Compare findings across multiple cell lines representing different tissues

    • Validate key findings in primary cells when possible

  • Technical Variables:

    • Discrepancies may arise from different detection methods

    • Solution: Use multiple approaches (qRT-PCR, western blot, immunohistochemistry)

    • Standardize protocols and reagents across experiments

  • Regulatory Network Differences:

    • GPX8 may be regulated differently depending on the tumor microenvironment

    • Solution: Characterize the regulatory networks in each model system

    • Consider the influence of cancer-associated fibroblasts, which may express GPX8

What considerations are important when translating mouse Gpx8 findings to human systems?

When translating between species:

  • Sequence and Structural Comparison:

    • Analyze sequence homology between mouse and human GPX8

    • Identify conserved and divergent domains

    • Consider how differences might affect function and interactions

  • Expression Pattern Differences:

    • Compare tissue distribution patterns between species

    • Note differences in regulatory elements in promoter regions

    • Consider species-specific post-transcriptional regulation

  • Experimental Validation:

    • Confirm key findings in both mouse and human cell lines

    • Use patient-derived samples when possible to validate clinical relevance

    • Consider humanized mouse models for in vivo translation

  • Pathway Conservation Analysis:

    • Determine if interacting partners (IL-6/STAT3, Hsc70/AKT) function similarly

    • Assess conservation of regulatory mechanisms

    • Validate pathway interactions in human systems

What are promising areas for future investigation of mouse Gpx8 functions?

Emerging research opportunities include:

  • Cancer Microenvironment Interactions:

    • GPX8 is expressed in cancer-associated fibroblasts (CAFs) and associated with CAF infiltration

    • Investigating GPX8's role in cancer-stroma communication could reveal new insights

    • Potential focus on how GPX8 in CAFs influences cancer cell migration

  • Therapeutic Targeting:

    • Bromodomain extra-terminal inhibitor JQ1 downregulates GPX8 expression

    • This suggests potential for epigenetic regulation of GPX8

    • Explore BRD2 and BRD4 as transcriptional regulators of GPX8

  • Metabolic Regulation:

    • GPX8 may influence metabolic reprogramming in cancer cells

    • Investigating connections between GPX8, redox balance, and cellular metabolism

    • Potential impact on cancer cell adaptation to metabolic stress

  • Immune System Interactions:

    • Explore how GPX8-mediated regulation of IL-6 might influence immune responses

    • Potential role in modulating tumor-associated inflammation

    • Effects on immune cell recruitment and function

How can single-cell analysis techniques advance our understanding of mouse Gpx8 biology?

Single-cell approaches offer new insights:

  • Single-Cell RNA Sequencing:

    • Resolve heterogeneity in GPX8 expression within tissues

    • Identify cell populations with coordinated expression of GPX8 and partner proteins

    • Map GPX8 to specific cell states during disease progression

  • Spatial Transcriptomics:

    • Localize GPX8 expression within tissue architecture

    • Correlate with markers of hypoxia, oxidative stress, or ER stress

    • Investigate spatial relationships between GPX8-expressing cells and microenvironment features

  • CyTOF/Mass Cytometry:

    • Simultaneous detection of GPX8 with multiple signaling proteins

    • Profile activation states of GPX8-related pathways at single-cell resolution

    • Identify rare cell populations with unique GPX8 expression patterns

  • Live-Cell Imaging:

    • Track dynamic changes in GPX8 localization during stress responses

    • Monitor protein-protein interactions in real-time

    • Correlate GPX8 activity with functional outcomes at the single-cell level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.