Recombinant Mouse Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of PPAPDC3

PPAPDC3 (Phosphatidic acid phosphatase type 2 domain containing 3) is a 271 amino acid multi-pass membrane protein that belongs to the PA-phosphatase related phosphoesterase family. In mouse, this protein is encoded by the Ppapdc3 gene, which maps to chromosome 2 B . The protein is also known by several alternative names including Plpp7 (Phospholipid phosphatase 7), Net39 (Nuclear envelope transmembrane protein 39), and D830019K17Rik .

The significance of PPAPDC3 in research stems primarily from its specialized role in muscle development and homeostasis. Studies have demonstrated its high expression in cardiac and skeletal muscle tissues, where it functions as a negative regulator of myoblast differentiation. This regulation operates partly through effects on FRAP (FKBP12-rapamycin-associated protein) signaling pathways, making recombinant PPAPDC3 an invaluable tool for investigating muscle development mechanisms .

Table 1: Key Characteristics of Recombinant Mouse PPAPDC3

CharacteristicDescription
Protein Length271 amino acids (full-length)
Molecular WeightApproximately 29 kDa
UniProt IDQ91WB2
Gene LocationChromosome 2 B (mouse)
Alternative NamesPlpp7, Net39, D830019K17Rik
Protein FamilyPA-phosphatase related phosphoesterase family
Common TagN-terminal His tag
Typical SourceRecombinant expression in E. coli
Purity>85-90% (SDS-PAGE)
FormLyophilized powder

Subcellular Distribution

PPAPDC3 primarily localizes to the nuclear envelope and endoplasmic reticulum membrane . This specific subcellular localization aligns with its regulatory functions in intracellular signaling and potential influence on gene expression related to muscle development. The protein is oriented within these membranes such that both N-terminal and C-terminal regions face the cytoplasm or nucleoplasm, facilitating interactions with cytoplasmic signaling components .

Tissue-Specific Expression

Research has established that PPAPDC3 exhibits a highly tissue-specific expression pattern, with predominant expression in cardiac and skeletal muscle tissues . This specialized distribution correlates with its identified function as a regulator of myoblast differentiation and muscle homeostasis, suggesting evolutionary adaptation for specific roles in muscle biology.

The focused expression in muscle tissues makes PPAPDC3 particularly relevant for research into muscle development, function, and related disorders. This tissue specificity provides researchers with a target that may have specialized functions in muscle contexts without broader systemic effects that might complicate interpretation of experimental results.

Regulation of Myoblast Differentiation

A primary function of PPAPDC3 is its activity as a negative regulator of myoblast differentiation . Myoblasts are embryonic progenitor cells that ultimately develop into mature muscle cells (myocytes). The precise regulation of myoblast differentiation represents a critical process for proper muscle development, regeneration, and maintenance throughout life.

PPAPDC3 appears to modulate this differentiation process, potentially by influencing the timing, extent, or specific pathways involved in myoblast maturation. By serving as a negative regulator, it may help ensure that differentiation occurs at appropriate developmental stages and under suitable conditions, preventing premature or excessive differentiation that could compromise muscle development.

FRAP Signaling and IGF-II Expression

PPAPDC3 exerts its effects on myoblast differentiation partly through the FRAP signaling pathway . Specifically, it controls FRAP-dependent Insulin-like Growth Factor II (IGF-II) expression during the differentiation process. IGF-II is a crucial growth factor that promotes cell proliferation, differentiation, and survival, particularly in the context of muscle development.

By regulating IGF-II expression through FRAP signaling, PPAPDC3 appears to participate in a key pathway that governs muscle cell maturation and function. This regulatory role places PPAPDC3 within an important signaling network controlling muscle development.

Muscle Homeostasis Contributions

Beyond its role in differentiation, PPAPDC3 likely contributes to ongoing muscle homeostasis activities . While the specific mechanisms remain under investigation, the protein appears to be part of the regulatory machinery that maintains muscle tissue integrity and function throughout the lifespan.

The protein's continued expression in mature muscle tissues suggests it plays ongoing roles beyond development, potentially in processes such as muscle adaptation, repair, or metabolism. These functions may become particularly relevant in contexts of muscle injury, exercise adaptation, or disease states affecting muscle tissue.

Expression Systems

Recombinant mouse PPAPDC3 protein can be produced using various expression systems, each offering distinct advantages for different research applications:

E. coli Expression System: The most common approach for producing recombinant PPAPDC3 involves cloning the full-length mouse Ppapdc3 gene into an expression vector with an N-terminal His tag and expressing it in E. coli . This bacterial system offers high yield and cost-effectiveness, making it suitable for producing substantial quantities of the protein for structural studies or antibody production.

Cell-Free Expression System: Some commercial sources offer recombinant mouse PPAPDC3 produced in cell-free expression systems . These systems can provide advantages for producing membrane proteins by avoiding potential toxicity issues that might occur in cellular systems.

Alternative Systems: Though less commonly documented for mouse PPAPDC3 in the available literature, other potential expression platforms include yeast, baculovirus-infected insect cells, or mammalian cell systems . These systems may offer improved post-translational modifications and folding for complex proteins when functional authenticity is paramount.

Purification and Quality Control

The typical purification process for His-tagged recombinant mouse PPAPDC3 involves:

  1. Cell lysis to release the expressed protein

  2. Affinity chromatography using nickel or cobalt resins that selectively bind the His-tag

  3. Washing steps to remove non-specifically bound proteins

  4. Elution of purified protein

  5. Quality control testing

Quality assessment generally includes SDS-PAGE analysis to confirm protein purity (typically >85-90%) , and may also involve mass spectrometry or Western blotting to verify protein identity. The final product is often lyophilized for stability and supplied with detailed reconstitution protocols to ensure optimal protein functionality upon use.

Current Research Applications

Recombinant mouse PPAPDC3 protein serves multiple research purposes in contemporary scientific investigations:

Antibody Development: The purified protein serves as an immunogen for developing antibodies against PPAPDC3 for detection in Western blotting, immunofluorescence, and other immunoassay applications .

Protein Interaction Studies: Recombinant PPAPDC3 enables investigations of protein binding partners and regulatory networks, providing insights into the protein's functional relationships.

Enzymatic Characterization: Though designated as a "probable" lipid phosphate phosphatase, recombinant protein facilitates studies to definitively characterize enzymatic activities and substrate preferences.

Muscle Development Research: The protein's role in myoblast differentiation makes it valuable for studies investigating muscle development, regeneration, and related disorders.

Experimental Tools and Approaches

Several molecular tools are available for studying PPAPDC3 function:

CRISPR/Cas9 System: PPAPDC3 Double Nickase Plasmids have been developed to disrupt the Ppapdc3 gene in mice, facilitating gene knockout studies . These plasmids employ paired guide RNAs (gRNAs) and a D10A mutated Cas9 nuclease to create highly specific double nicking of the Ppapdc3 gene, mimicking a double-strand break.

RNA Interference: Small interfering RNA (siRNA) and short hairpin RNA (shRNA) approaches provide transient knockdown of PPAPDC3 expression for functional studies . Commercial options include PPAPDC3 siRNA for mouse (sc-152404) and PPAPDC3 shRNA Plasmid for mouse (sc-152404-SH).

Antibody-Based Detection: Specific antibodies for PPAPDC3 enable detection in Western blotting and immunofluorescence applications . These antibodies typically target specific epitopes, such as the P-17 epitope (sc-248296), and may be available with various secondary detection options.

Table 2: Research Tools for Studying Mouse PPAPDC3

Research ToolDescriptionApplicationReference
Recombinant ProteinFull-length protein with His-tagAntibody production, enzyme assays
PPAPDC3 Double Nickase PlasmidCRISPR/Cas9 system for gene disruptionGene knockout studies
siRNA/shRNARNA interference toolsTransient knockdown studies
Anti-PPAPDC3 AntibodiesSpecific antibodies against mouse PPAPDC3Western blot, immunofluorescence

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Plpp7; Net39; Ppapdc3; Inactive phospholipid phosphatase 7; Nuclear envelope transmembrane protein 39; Phosphatidic acid phosphatase type 2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plpp7
Target Protein Sequence
MPASQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG HGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDV ISGFIIGYFQFRLVELVWMSSNTCQMLISAW
Uniprot No.

Target Background

Function
Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3) acts as a negative regulator of myoblast differentiation, partly through its influence on mTOR signaling. It exhibits no detectable enzymatic activity. Knockdown in myoblasts significantly promotes differentiation, while overexpression suppresses myogenesis.
Gene References Into Functions
  1. The nuclear lamina-associated nuclear envelope transmembrane protein NET39 (Ppapdc3) functions as a negative regulator of myoblast differentiation. PMID: 19704009
Database Links

KEGG: mmu:227721

UniGene: Mm.257236

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein. Note=Both the N- and C-terminal are exposed to the cytoplasm/nucleoplasm.
Tissue Specificity
Highly expressed in heart and muscle.

Q&A

What is the function of Mouse PPAPDC3 in cellular metabolism?

PPAPDC3 (also known as NET39) is a nuclear envelope-localized protein that belongs to the lipid phosphate phosphatase family. Unlike its related protein PPAPDC2 (PDP1), PPAPDC3 does not exhibit lipid phosphatase activity despite structural similarities . While PPAPDC2 actively dephosphorylates polyisoprenoid diphosphates like farnesyl diphosphate (FPP) and geranylgeranyl diphosphate (GGPP), PPAPDC3's exact function remains less characterized. Its specific localization to the nuclear envelope suggests potential roles in nuclear membrane structure maintenance or signaling pathways associated with the nuclear architecture.

How does PPAPDC3 differ structurally from other lipid phosphate phosphatases?

The table below compares key structural features of PPAPDC3 with related proteins:

ProteinTransmembrane TopologyCatalytic MotifsPhosphatase ActivityPrimary Localization
PPAPDC3/NET394 TM domainsNot conservedNot detectedNuclear envelope
PPAPDC2/PDP14 TM domainsConservedActiveER and nuclear envelope
PPAPDC14 TM domainsNot conservedNot detectedVarious membranes
Classical LPPs6 TM domainsConservedActivePlasma membrane, ER, Golgi

What is the subcellular localization of PPAPDC3?

PPAPDC3 has been definitively identified as a nuclear envelope-localized protein . This specific localization distinguishes it from some related proteins like PPAPDC2, which predominantly localizes to the endoplasmic reticulum with only a subfraction present in the nuclear envelope. The distinct localization pattern suggests specialized functions related to nuclear envelope biology rather than general lipid metabolism in other cellular compartments.

What experimental approaches are recommended for studying PPAPDC3 expression?

For comprehensive analysis of PPAPDC3 expression, researchers should implement:

  • Quantitative RT-PCR to measure transcript levels across tissues

  • Western blotting with validated antibodies for protein expression

  • Immunohistochemistry to visualize tissue distribution patterns

  • Fluorescent protein fusions carefully designed to avoid disruption of localization signals

  • Single-cell RNA sequencing to identify cell-type specificity

When analyzing expression data, researchers should normalize results using multiple reference genes and validate findings across independent detection methods.

What are the key experimental controls for PPAPDC3 research?

When designing experiments involving PPAPDC3, implement the following critical controls:

  • Use PPAPDC3 knockout cells/tissues to verify antibody specificity

  • Include catalytically active phosphatases (like PPAPDC2) as positive controls for enzyme assays

  • Employ site-directed mutagenesis to generate non-functional variants for domain analysis

  • Use subcellular fractionation controls to verify nuclear envelope enrichment

  • Include both creatinine-adjusted and unadjusted measurements when analyzing urinary metabolites that might be affected by PPAPDC3 activity

How can researchers distinguish between direct and indirect effects of PPAPDC3 manipulation?

Distinguishing direct from indirect effects requires systematic experimental design:

  • Generate conditional knockout models with temporal control to observe immediate versus delayed consequences

  • Implement rescue experiments with WT and mutant PPAPDC3 variants

  • Use proximity labeling techniques (BioID, APEX) to identify direct interaction partners

  • Compare phenotypes with those resulting from manipulation of known PPAPDC3 interactors

  • Utilize rapid protein degradation systems (e.g., auxin-inducible degron) to differentiate acute from chronic effects

Researchers should be aware that, unlike PPAPDC2, PPAPDC3 lacks lipid phosphatase activity, meaning that its effects on cellular processes are likely mediated through protein-protein interactions or structural roles rather than enzymatic activity .

What is the relationship between PPAPDC3 and nuclear envelope dynamics?

Given PPAPDC3's localization to the nuclear envelope , researchers investigating its role in nuclear dynamics should:

  • Conduct live-cell imaging with fluorescently-tagged PPAPDC3 during cell cycle progression

  • Assess changes in nuclear envelope breakdown and reformation in PPAPDC3-depleted cells

  • Evaluate interactions with key nuclear envelope proteins including lamins and nuclear pore complex components

  • Analyze nuclear shape and rigidity using atomic force microscopy in control versus PPAPDC3-manipulated cells

  • Examine chromatin organization at the nuclear periphery using DamID or FISH techniques

Preliminary evidence suggests PPAPDC3 may influence nuclear envelope morphology, similar to the effects observed with overexpression of the related protein PPAPDC2 .

How do genotype-by-environment interactions affect PPAPDC3 function?

When investigating environmental influences on PPAPDC3 function, researchers should consider:

  • Implement multi-laboratory experimental designs to assess replicability across different environments

  • Calculate the "Genotype-by-Laboratory" (GxL) factor to quantify interaction effects

  • Test cellular stressors including oxidative stress, osmotic pressure, and temperature variation

  • Monitor PPAPDC3 localization and interaction patterns across diverse conditions

  • Use standardized protocols while systematically varying specific parameters to identify critical factors

Research on related proteins suggests that environmental conditions can substantially alter membrane protein function, emphasizing the importance of accounting for these interactions in experimental design .

What role might PPAPDC3 play in lipid metabolism networks?

Despite lacking lipid phosphatase activity, PPAPDC3 may still influence lipid metabolism through:

  • Acting as a scaffold protein for active enzymes within the nuclear envelope

  • Regulating the localization or access of substrates to active phosphatases

  • Influencing membrane properties that affect enzyme function

  • Participating in feedback loops that regulate lipid synthesis pathways

  • Serving as a sensor for lipid composition changes

For related phosphatases like PDP1/PPAPDC2, overexpression depletes cellular pools of FPP and GGPP, leading to growth defects and sterol auxotrophy . Researchers should investigate whether PPAPDC3 modulates these pathways indirectly.

How can mass spectrometry approaches be optimized for PPAPDC3 research?

Based on methodologies used for related proteins, researchers should consider:

  • Employ tandem mass spectrometry to evaluate potential protein-lipid interactions

  • Use stable isotope labeling to track metabolic changes in the presence/absence of PPAPDC3

  • Implement creatinine normalization for urinary metabolites when studying systemic effects

  • Apply appropriate extraction methods optimized for membrane proteins

  • Consider crosslinking mass spectrometry to capture transient interactions

For sample preparation, researchers should note that limits of detection for sensitive metabolites typically range from 0.067 to 0.67 ng/mL when using coupled mass spectrometry techniques .

What are the most effective methods for purifying recombinant mouse PPAPDC3?

For optimal purification of this integral membrane protein:

  • Express PPAPDC3 in mammalian cells rather than bacterial systems to ensure proper folding and post-translational modifications

  • Utilize mild detergents (digitonin, DDM, or CHAPS) during extraction to preserve native conformation

  • Implement a two-step purification strategy:

    • Initial capture via affinity chromatography (His-tag or FLAG-tag)

    • Follow with size exclusion chromatography to remove aggregates

  • Verify intact transmembrane domains using circular dichroism

  • Confirm proper folding through limited proteolysis assays

When testing purification efficiency, monitor yield and purity at each step using SDS-PAGE and Western blotting with antibodies specific to PPAPDC3.

What genotyping strategies are most reliable for PPAPDC3 knockout models?

Implement a multi-method approach for reliable genotyping:

  • Design PCR primers that distinguish between wild-type and modified alleles

  • Validate genomic modifications through Sanger sequencing of the targeted region

  • Confirm protein absence using Western blotting

  • Verify loss of nuclear envelope localization through immunofluorescence

  • Use quantitative PCR to detect potential unexpected genomic rearrangements

Data quality control should include positive and negative controls, and researchers should be aware that genotype-by-laboratory interactions can significantly impact phenotypic outcomes in mouse models .

How can researchers effectively visualize PPAPDC3 localization?

For optimal subcellular localization studies:

  • Combine fixed-cell immunofluorescence with live-cell imaging of fluorescent protein fusions

  • Use validated antibodies and verify specificity in knockout controls

  • Co-stain with established nuclear envelope markers (lamin B1, nuclear pore complex proteins)

  • Employ super-resolution microscopy (STORM, PALM) to precisely map localization

  • Complement optical techniques with immunogold electron microscopy for ultrastructural resolution

When interpreting localization data, consider that C-terminal tags on related proteins have shown susceptibility to proteolysis in saponin-permeabilized cells, potentially complicating analysis .

What approaches can determine if PPAPDC3 interacts with other nuclear envelope proteins?

To characterize the interactome of PPAPDC3:

  • Implement co-immunoprecipitation studies optimized for membrane proteins

  • Use proximity labeling methods (BioID, APEX) to identify neighboring proteins

  • Apply FRET or BRET assays to detect direct interactions in living cells

  • Perform split-reporter complementation assays for binary interaction validation

  • Conduct comparative interactome analyses between PPAPDC3 and other PPAPDC family members

When analyzing interaction data, prioritize candidates that consistently appear across multiple methodologies and consider that interactions may be dynamic or condition-dependent.

How should researchers approach functional studies in PPAPDC3-deficient models?

For comprehensive functional analysis:

  • Generate both constitutive and inducible knockout models to distinguish developmental from acute effects

  • Implement tissue-specific deletions to identify cell-autonomous functions

  • Conduct rescue experiments with wild-type and mutant variants

  • Perform phenotypic analyses across multiple systems, with particular attention to:

    • Nuclear morphology and integrity

    • Cell division dynamics

    • Lipid metabolism pathways despite lacking direct enzymatic activity

  • Consider potential compensatory mechanisms by related proteins

Unlike PPAPDC2, where overexpression causes growth defects and cytoskeletal disorganization , PPAPDC3 manipulation may produce more subtle phenotypes related to nuclear envelope function, requiring sensitive detection methods.

How can researchers ensure replicability in PPAPDC3 studies?

To maximize experimental replicability:

  • Calculate the Genotype-by-Laboratory (GxL) factor when designing multi-lab studies

  • Use the GxL factor as a statistical approach to estimate interlaboratory replicability

  • Implement standardized protocols while systematically documenting any variations

  • Pre-register experimental designs and analysis plans

  • Share raw data and detailed methodologies through repositories

Research indicates that using the GxL factor can significantly reduce the probability of non-replicable results from 59.6% to 12.1% in mouse studies .

What statistical approaches are recommended for analyzing PPAPDC3 experimental data?

For robust statistical analysis:

  • Perform power analyses based on expected effect sizes before beginning experiments

  • Account for potential batch effects and laboratory variations

  • Apply appropriate normalization methods for different data types

  • Use non-parametric tests when distributions deviate from normality

  • Consider mixed-effects models to account for repeated measures and hierarchical data structures

When analyzing genetic data related to PPAPDC3, researchers should filter samples based on call rate (>97%), check for sex inconsistencies, and exclude samples with heterozygosity >3 standard deviations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.