Recombinant Mouse Probable low affinity copper uptake protein 2 (Slc31a2)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

Slc31a2 belongs to the solute carrier family 31 (SLC31) of copper transporters. Key functional insights include:

  • Copper Homeostasis: Facilitates low-affinity copper uptake and mobilizes intracellular copper stores from endosomes/lysosomes .

  • Regulatory Role: Modulates SLC31A1 (CTR1) activity by stabilizing its truncated form, influencing copper and cisplatin accumulation .

  • Localization: Primarily resides in intracellular membranes (e.g., late endosomes, lysosomes) rather than the plasma membrane .

Studies in mice reveal that Slc31a2 expression decreases under copper supplementation, suggesting feedback regulation .

Production and Validation

Recombinant Slc31a2 is produced using E. coli expression systems, ensuring high yield and purity . Validation methods include:

  • Western Blot: Detected in mouse pancreas using anti-Slc31a2 polyclonal antibodies (e.g., CAB16362) .

  • ELISA: Quantifiable in tissue homogenates with a sensitivity range of 0.156–10 ng/ml .

  • Functional Assays: Demonstrated copper transport activity in vitro, albeit with lower affinity compared to CTR1 .

Disease Modeling

  • Copper-Related Disorders: Used to study Menkes disease and Wilson’s disease, where copper metabolism is disrupted .

  • Cancer Research: Linked to cisplatin resistance; knockdown enhances cisplatin uptake in cancer cells .

Mechanistic Studies

  • Subcellular Trafficking: Localization studies using immunofluorescence reveal its role in vesicular copper release .

  • Gene Expression Analysis: RT-qPCR profiles show tissue-specific expression, with high levels in the liver and kidney .

Drug Development

  • Therapeutic Target: Explored for modulating copper bioavailability in neurodegenerative diseases .

Comparative Insights

SpeciesProteinKey Differences
HumanSLC31A2 (O15432)143 aa, 87% sequence identity to mouse
ZebrafishSLC31A2Functional conservation in copper transport
ChickenSLC31A2Limited data; structural homology confirmed

Challenges and Future Directions

  • Functional Redundancy: Overlap with CTR1 complicates phenotype interpretation in knockout models .

  • Structural Studies: Full 3D conformation remains unresolved, hindering drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
Slc31a2; Probable low affinity copper uptake protein 2; Copper transporter 2; CTR2; Solute carrier family 31 member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc31a2
Target Protein Sequence
MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPA TNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLNMT
Uniprot No.

Target Background

Function
Involved in low-affinity copper uptake.
Gene References Into Functions
  1. Increased granular staining and heparin content suggest an impact of Ctr2 on mast cell maturation. Supporting this, Ctr2 absence resulted in significantly increased tryptase mRNA expression, storage, and enzymatic activity. PMID: 26342034
  2. In mouse embryo fibroblasts, reduced CTR1 expression confers cisplatin resistance, while reduced CTR2 expression increases hypersensitivity both in vitro and in vivo. PMID: 24522273
  3. Ctr2 regulates the biogenesis of a cleaved mammalian Ctr1 metal transporter form lacking the copper- and cisplatin-binding ectodomain. PMID: 24167251
  4. Copper transporter 2 modulates cisplatin transport by controlling macropinocytosis rates. PMID: 20930109
Database Links
Protein Families
Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.