Recombinant Mouse Probable N-acetyltransferase 8B (Nat8b)

Shipped with Ice Packs
In Stock

Description

Introduction to N-acetyltransferase 8B

N-acetyltransferase 8B (Nat8b), also known as ATase1, is an enzyme involved in Nε-lysine acetylation of nascent proteins within the lumen of the endoplasmic reticulum. This acetylation process serves as a quality control mechanism that ensures protein homeostasis (proteostasis) within the secretory pathway . Nat8b is one of two ER-membrane bound acetyltransferases, alongside ATase2/NAT8, that catalyze this reaction. These enzymes work in tandem with AT-1/SLC33A1, an ER-membrane antiporter that moves acetyl-CoA from the cytosol into the lumen of the ER in exchange for free CoA .

The gene status of Nat8b varies between species. In humans, NAT8B resulted from duplication of the NAT8 gene in the primate lineage, but contains a premature stop codon at position 16, rendering it inactive . In contrast, mouse Nat8b appears to be functional, though it is sometimes referenced as Nat8b-ps (pseudogene) in some databases . This species difference makes the recombinant mouse form particularly valuable for studying the biological functions of this acetyltransferase.

Molecular Features

Recombinant Mouse Probable N-acetyltransferase 8B is produced as a full-length protein consisting of 232 amino acids. The complete amino acid sequence is:

MPRFEAQKSSMVPYHIRQYQDSDHKRVVDVFTTGAEEYIPSTFRHVLRLPRTFLLLLGVP LALVLVSGSWILAVICIFFLLLLLRLLARQPWKEYVAKCLQTYMVDITKSYLNVHGACFW VAESGGQVVGIVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSY SDVVLETSTLQQGAMTLYLGMGFKKTGQYFKSMFWRLVDICFIQLNYSFPSA

Structurally, Nat8b is a type-II membrane protein with its catalytic domain facing the ER lumen . This orientation is crucial for its function in acetylating nascent proteins within the ER.

Role in ER Acetylation and Protein Quality Control

Nat8b functions as an acetyltransferase within the ER lumen, where it catalyzes the Nε-lysine acetylation of nascent proteins. This post-translational modification plays a crucial role in protein quality control within the secretory pathway . The acetylation machinery, including Nat8b, is particularly important in highly metabolic and polarized cells that rely heavily on an efficient secretory pathway, such as neurons .

Recent research has demonstrated that reducing ER acetylation can induce reticulophagy (ER-specific autophagy), increase ER turnover, and alleviate proteotoxic states associated with various diseases . This suggests that modulating Nat8b activity could have therapeutic implications for conditions characterized by protein misfolding and aggregation.

Divergent Roles of Nat8b and NAT8

Studies using knockout mice have revealed that Nat8b (ATase1) and NAT8 (ATase2) play different roles in the regulation of reticulophagy and macroautophagy . Importantly, knockout of Nat8b alone results in activation of reticulophagy and rescue of the proteotoxic state associated with Alzheimer's disease . Furthermore, loss of either Nat8b or NAT8 results in widespread adaptive changes in the cell acetylome and acetyl-CoA metabolism, highlighting their importance in cellular homeostasis.

These findings emphasize the divergent roles of Nat8b and NAT8 in cellular biology and suggest that Nat8b could be a valid translational target for diseases characterized by toxic protein aggregation in the secretory pathway .

Chemical Modulation of Nat8b Expression

Several chemicals have been found to affect Nat8b expression, as documented in the Rat Genome Database. The table below summarizes some of these interactions:

Chemical CompoundEffect on Nat8bEvidence Type
2,2',4,4'-Tetrabromodiphenyl etherDecreases expressionExperimental
2,3,7,8-tetrachlorodibenzodioxineDecreases expressionExperimental
3-chloropropane-1,2-diolDecreases expressionExperimental
6-propyl-2-thiouracilDecreases expressionExperimental
Bisphenol AIncreases expressionExperimental
Aflatoxin B1Increases expressionISO (based on human NAT8B)
Aflatoxin B1Decreases methylationISO (based on human NAT8B)

Table 2: Chemical compounds affecting Nat8b expression and methylation

These chemical interactions provide insights into potential regulatory mechanisms of Nat8b expression and suggest that environmental factors may influence ER acetylation processes through modulation of Nat8b levels.

Functional Significance of Acetylation

The Nε-lysine acetylation catalyzed by Nat8b appears to be functionally significant for protein homeostasis. Research has shown that dysfunctional ER acetylation, as caused by loss-of-function mutations or gene duplication events, is associated with severe inherited diseases . This underscores the importance of proper ER acetylation in maintaining cellular health and function.

Neurodegenerative Disease Research

The finding that knockout of Nat8b can rescue the proteotoxic state associated with Alzheimer's disease suggests that this protein may be a valuable target for neurodegenerative disease research . Recombinant Mouse Nat8b provides researchers with a tool to investigate the mechanisms by which ER acetylation affects protein aggregation and neurodegeneration.

Studies using Nat8b knockout mice have shown that reducing ER acetylation through elimination of Nat8b can induce reticulophagy, increase ER turnover, and alleviate proteotoxic states . These findings suggest that inhibition of Nat8b could potentially be developed as a therapeutic strategy for conditions characterized by protein misfolding and aggregation in the secretory pathway.

Viral Infection Studies

While much of the research on acetyltransferases has focused on NAT8 rather than Nat8b, studies have shown that ER-resident acetyltransferases can influence viral replication. Research has identified NAT8 as a host factor for enterovirus 71 (EV71) infection, promoting viral replication in an acetyltransferase-activity-dependent manner .

The findings with NAT8 raise the possibility that Nat8b might also play roles in host-virus interactions, though more specific studies on Nat8b are needed. Recombinant Mouse Nat8b provides a valuable tool for investigating these potential interactions.

Comparative Studies with Human NAT8B

Given that human NAT8B is considered an inactive gene due to a premature stop codon , while mouse Nat8b appears to be functional, comparative studies between the two can provide insights into species-specific differences in ER acetylation mechanisms. The recombinant mouse form allows researchers to study the functional aspects of this acetyltransferase that may not be accessible through studies of the human ortholog.

Experimental Applications

Recombinant Mouse Nat8b can be used in various experimental applications, including:

  1. SDS-PAGE analysis for protein characterization

  2. Enzymatic activity assays to measure acetyltransferase function

  3. Protein-protein interaction studies to identify binding partners

  4. In vitro acetylation assays to identify potential substrates

  5. Structural studies to elucidate the protein's catalytic mechanism

These applications provide valuable insights into the functional properties of Nat8b and its role in ER acetylation processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Nat8b-ps; Cml2; Putative N-acetyltransferase 8B; Camello-like protein 2; Putative acetyltransferase 1; ATase1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nat8b-ps
Target Protein Sequence
MPRFEAQKSSMVPYHIRQYQDSDHKRVVDVFTTGAEEYIPSTFRHVLRLPRTFLLLLGVP LALVLVSGSWILAVICIFFLLLLLRLLARQPWKEYVAKCLQTYMVDITKSYLNVHGACFW VAESGGQVVGIVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSY SDVVLETSTLQQGAMTLYLGMGFKKTGQYFKSMFWRLVDICFIQLNYSFPSA
Uniprot No.

Target Background

Function

Recombinant Mouse Probable N-acetyltransferase 8B (Nat8b) exhibits lysine N-acetyltransferase activity, catalyzing the N6-acetylation of peptidyl-lysine residues in various proteins. This activity may regulate apoptosis via acetylation and expression modulation of PROM1. Additionally, Nat8b may regulate amyloid beta-peptide secretion through the acetylation and expression regulation of BACE1 in neurons.

Database Links
Protein Families
Camello family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in brain (at protein level).

Q&A

What is mouse N-acetyltransferase 8B (Nat8b) and what is its functional significance?

Nat8b (also known as ATase1) is an endoplasmic reticulum (ER) acetyltransferase that participates in Nε-lysine acetylation of nascent glycoproteins within the ER lumen. It functions alongside AT-1 (acetyl-CoA transporter) and ATase2/NAT8 as part of the ER acetylation machinery . This acetylation process regulates the efficiency of the secretory pathway, which is particularly crucial in highly metabolic and polarized cells such as neurons .

Research has demonstrated that the ER acetylation machinery plays a significant role in neurophysiology, with dysregulation associated with neurological conditions including autism spectrum disorder, intellectual disability, and sensory neuropathies .

How does Nat8b/ATase1 differ from Nat8/ATase2 structurally and functionally?

While Nat8b (ATase1) and Nat8 (ATase2) share approximately 90% sequence identity and similar enzymatic properties, they exhibit important differences in regulation and function :

CharacteristicNat8b/ATase1Nat8/ATase2
Post-translational regulationRegulated via acetylationNot regulated via acetylation
Gene expression regulationContains specific binding sites for neuron-related transcription factors (CREB, c-FOS, c-JUN)Similar binding sites but additional transcriptional regulation modes
Human functionalityInactive in humans due to premature stop codon at position 16Active in humans
Evolutionary conservationLess conserved across speciesMore conserved across species

Nat8 has also been identified as a functional enzyme involved in mercapturic acid formation, while Nat8b has been confirmed as an inactive gene in humans .

What is the cellular localization of Nat8b and how does this influence its function?

Nat8b is a type-II membrane protein localized to the endoplasmic reticulum (ER) lumen . The protein contains:

  • A relatively conserved region of approximately 30 amino acids

  • A hydrophobic stretch of ~30 residues responsible for membrane attachment

  • A C-terminal region of about 120 residues that aligns with other N-acetyltransferases and likely includes most of the catalytic site

This ER localization is critical for its function in acetylating nascent glycoproteins as they transit through the secretory pathway. The membrane attachment domain ensures proper positioning within the ER to access both substrates (nascent proteins) and cofactors (acetyl-CoA provided by AT-1 transporter) .

What are the key considerations when designing experiments with recombinant mouse Nat8b?

When designing experiments with recombinant mouse Nat8b, researchers should consider:

  • Protein stability and storage conditions: Recombinant Nat8b should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses. Avoid repeated freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (recommended final concentration: 50%) for long-term storage

  • Species differences: Mouse Nat8b is functional, while human NAT8B contains a premature stop codon. This critical difference must be accounted for when designing translational studies .

  • Expression systems: E. coli has been successfully used for recombinant expression of full-length mouse Nat8b (1-232 amino acids) with N-terminal His-tag .

  • Potential cytotoxicity: Overexpression of NAT8 has been shown to lead to cell death in transfected HEK293T cells, with significant effects on lactate dehydrogenase release. Similar effects might occur with Nat8b and should be monitored in experimental designs .

How can researchers effectively generate and validate Nat8b knockout models?

Based on established knockout methodologies, researchers should implement the following approach :

  • Targeting vector construction:

    • Obtain bacterial artificial chromosome (BAC) clones containing the entire Nat8b gene

    • Construct a knockout targeting vector containing a floxed Neo selection cassette using traditional cloning techniques and recombineering

    • Include appropriate flanking sequences for homologous recombination

  • ES cell targeting:

    • Linearize the completed targeting vector and introduce by electroporation into murine ES cells (e.g., JM8A3 C57BL/6N-derived cells)

    • Select cells that integrated the targeting vector using G418

    • Use gancyclovir (GANC) to select against clones containing the HSV-TK cassette

    • Verify clone integrity by Southern blot and DNA sequence analysis

    • Confirm euploidy through chromosome counting

  • Chimera generation and breeding:

    • Microinject verified ES cells into C57BL/6 blastocysts

    • Mate highly chimeric male founders with C57BL/6 females

    • Genotype F1 pups to identify those carrying the gene-targeted allele

    • Remove the Neo cassette by breeding with Cre-expressing mice

  • Validation primers:

    • For genotyping F1 pups: Forward: 5′-ATAGCAGGCATGCTGGGGAT-3′, Reverse: 5′-GGCTCAGTAAAACACAGGCC-3′ (359 bp amplicon)

    • For Neo cassette removal screening: Forward: 5′-GGACAGACACTCTCCCAGTTAGTG-3′, Reverse: 5′-GGCTCAGTAAAACACAGGCC-3′ (1000 and 437 bp amplicons)

What methods are effective for studying Nat8b's enzymatic activity in vitro?

To study Nat8b's enzymatic activity in vitro, researchers should consider the following approaches:

  • Acetyltransferase assays:

    • Use recombinant full-length mouse Nat8b protein (His-tagged) expressed in E. coli

    • Set up reactions containing purified Nat8b, acetyl-CoA as donor, and appropriate substrate proteins

    • Measure transfer of acetyl groups to lysine residues using:

      • Radioactive assays with [14C]-acetyl-CoA

      • Antibody-based detection of acetylated lysines

      • Mass spectrometry to identify specific acetylated residues

  • Structure-function analyses:

    • Generate mutations in catalytic residues to assess their importance (based on homology with NAT8)

    • Create domain-swapping constructs between Nat8b and NAT8 to determine functional regions

  • Substrate identification:

    • Perform in vitro acetylation reactions with potential substrates followed by mass spectrometry

    • Use proximity labeling approaches to identify interacting proteins in cellular contexts

  • Controls:

    • Include enzymatically inactive mutants (based on conserved catalytic residues)

    • Compare with human NAT8B (inactive) and NAT8 (active) to validate specificity

What are the key differences between human NAT8B and mouse Nat8b, and how do these impact translational research?

Critical differences between human NAT8B and mouse Nat8b pose important considerations for translational research:

FeatureHuman NAT8BMouse Nat8b
FunctionalityInactive (premature stop codon at position 16)Functional protein
ExpressionTranscribed but produces a truncated proteinProduces full-length functional protein (232 aa)
Sequence variationRare instances of serine at position 16No premature stop codon
Gene duplicationOne of two NAT8 homologues in humansOne of multiple NAT8 homologs in mice (which has eight)

These differences necessitate caution when extrapolating findings from mouse models to human contexts. Specifically:

  • Mouse models using Nat8b may not directly translate to human disease contexts where NAT8B is naturally inactive

  • Any observed phenotypes from Nat8b manipulation in mice would likely be mediated by NAT8 (ATase2) in humans

  • Compensatory mechanisms may exist in humans that accommodate for the non-functional NAT8B

How has the Nat8 gene family evolved across vertebrate species?

The evolutionary analysis of the NAT8 gene family reveals fascinating patterns :

  • Gene duplication patterns:

    • All vertebrate genomes contain homologues of NAT8L and NAT8

    • Only one NAT8L gene per genome across all vertebrates

    • Variable numbers of NAT8 homologues:

      • One (dog and macaque)

      • Two (human, Pongo, horse, and Danio rerio)

      • Six (Monodelphis)

      • Seven (rat)

      • Eight (mice)

  • Genomic organization:

    • Multiple NAT8 homologues appear as tandemly repeated genes in one genomic location

    • This suggests the NAT8 gene underwent several duplication events in specific lineages

    • NAT8L, though structurally related, did not undergo similar duplication events

  • Sequence conservation:

    • NAT8 sequences show much lower conservation than NAT8L sequences

    • Example: Mouse and rat NAT8L show 100% identity in aligned regions

    • In contrast, the closest NAT8 homologues of mouse and rat (CML4) show only 90% identity

  • Evidence of recombination:

    • Rat nat8B was formed by recombination between cml1 and cml4

    • Multiple gene duplications in early vertebrate evolution followed by homologous recombination events have shaped the current evolutionary tree

How does Nat8b contribute to neuronal function and what implications does this have for neurological disorders?

Nat8b/ATase1 plays crucial roles in neuronal function through several mechanisms :

  • Regulation of secretory pathway efficiency:

    • Acetylation of nascent glycoproteins influences their processing and trafficking

    • This is particularly important in highly polarized neurons with extensive secretory demands

  • Neuronal morphology regulation:

    • The ER acetylation machinery influences neuron morphology

    • Altered acetylation patterns can affect neurite outgrowth and synapse formation

  • Transcriptional regulation:

    • Nat8b promoter contains functional binding sites for neuron-related transcription factors:

      • cAMP response element-binding protein (CREB)

      • Immediate early genes c-FOS and c-JUN

    • This suggests activity-dependent regulation of Nat8b expression

  • Implications for disorders:

    • While human NAT8B is inactive, mouse Nat8b studies provide insights into ER acetylation machinery

    • Dysregulation of AT-1 is associated with autism spectrum disorder, intellectual disability, and dysmorphism

    • Studying Nat8b can inform how the entire acetylation system functions in neuronal contexts

What role does Nat8b play in viral infections and host-pathogen interactions?

Recent research has uncovered a novel function of NAT8 in viral infections, which may provide insights for Nat8b research :

  • Viral replication promotion:

    • NAT8 has been identified as a host factor for Enterovirus 71 (EV71) infection

    • Inhibiting NAT8 (via CRISPR or small compounds) significantly suppresses EV71 infection

  • Mechanism of action:

    • NAT8 promotes viral replication in an acetyltransferase-activity-dependent manner

    • It interacts with EV71 proteins (2B, 3AB, and 3C) and increases their stability

  • Research implications for Nat8b:

    • Given the high sequence similarity between NAT8 and Nat8b (90%), investigating whether Nat8b has similar effects on viral replication could be valuable

    • Researchers should investigate:

      • Whether Nat8b interacts with viral proteins

      • If Nat8b knockout alters susceptibility to viral infection in mouse models

      • The comparative roles of NAT8 and Nat8b in different viral infection contexts

How can researchers address data contradictions when studying Nat8b across different experimental systems?

When encountering contradictory results in Nat8b research, consider these methodological approaches:

  • Systematic validation across systems:

    • Test findings in multiple cell lines and primary cultures

    • Validate in vivo results across different mouse strains

    • Compare results from different recombinant protein sources

  • Technical considerations:

    • Ensure recombinant protein quality through:

      • SDS-PAGE analysis (>90% purity)

      • Proper storage and handling to prevent protein degradation

      • Verification of His-tag integrity and accessibility

  • Address species-specific differences:

    • Acknowledge human NAT8B inactivity when interpreting translational results

    • Consider compensatory mechanisms in NAT8B-deficient organisms

  • Experimental design controls:

    • Include both positive controls (known functional enzymes) and negative controls

    • Use mutant variants (catalytically inactive) as additional controls

    • Document experimental conditions thoroughly to facilitate replication

  • Reporting practices:

    • Clearly state limitations of experimental systems

    • Report all negative or contradictory results

    • Provide complete methodological details including storage conditions, reconstitution methods, and experimental timeframes

What are the optimal conditions for handling and storing recombinant mouse Nat8b protein?

For optimal handling and storage of recombinant mouse Nat8b protein, researchers should follow these guidelines :

  • Initial storage:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening to bring contents to bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Working storage:

    • Keep working aliquots at 4°C for no longer than one week

    • Avoid repeated freezing and thawing

    • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for storage

  • Quality control:

    • Verify purity (>90%) by SDS-PAGE before experiments

    • Monitor protein stability over time and under experimental conditions

What promoter elements regulate Nat8b expression, and how can researchers manipulate its expression experimentally?

Understanding and manipulating Nat8b expression requires knowledge of its regulatory elements :

  • Key promoter elements:

    • The promoter region of NAT8B (human homolog) spans the transcriptional start site (+1) to 1,000 bases upstream

    • Contains functional binding sites for:

      • cAMP response element-binding protein (CREB)

      • Immediate early genes c-FOS and c-JUN

      • Additional transcription factors relevant to aging and Alzheimer's disease

  • Experimental manipulation techniques:

    • Promoter analysis tools:

      • Gene Promoter Miner

      • Jaspar

      • TFsitescan

      • PROMO

      • AliBaba2.1

      • MAPPER 2

    • Primer sets for promoter analysis:

      Primer SetForward SequenceReverse SequenceProduct Size
      NAT8B.15'-CCAGATTCCAATGCAGGTCTT-3'5'-TCCCTGCACGCCTTTAC-3'186 bp
      NAT8B.25'-ATGCACCAAGAAGCTGAGAG-3'5'-CCTTTCTAGCTGTGTGACCTTG-3'206 bp
      NAT8B.35'-CTGAGCATGCACCTTCCTT-3'5'-CTTGGTGCATTGAGAGAGTA-3'219 bp
      NAT8B.45'-CCTAGGGTTGATGATTACCAAACATCC-3'5'-ACTGTCCTTCCACCCAGT-3'181 bp
      NAT8B.55'-AGTATCAAGTGTGCCAGGTG-3'5'-GTCAAAGAGCTGGGCTGTAA-3'190 bp
    • Expression modulation:

      • Overexpression: Clone full-length Nat8b into appropriate expression vectors

      • Silencing: Design siRNAs targeting specific regions of Nat8b mRNA

      • Genomic editing: Use CRISPR/Cas9 with suitable guide RNAs

What are the most effective methods for studying protein-protein interactions involving Nat8b?

To investigate protein-protein interactions involving Nat8b, researchers can employ these methodologies:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His tag antibodies to pull down recombinant Nat8b

    • Identify interacting partners through Western blotting or mass spectrometry

    • Include appropriate controls to verify specificity of interactions

  • Yeast two-hybrid screening:

    • Clone Nat8b as bait protein

    • Screen against neuronal or ER-specific prey libraries

    • Validate positive interactions through secondary assays

  • Proximity labeling approaches:

    • Fuse Nat8b to BioID or APEX2

    • Express in relevant cell types to identify proximal proteins

    • Analyze biotinylated proteins through streptavidin pulldown and mass spectrometry

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescent protein fusions with Nat8b

    • Measure energy transfer between Nat8b and potential interacting partners

    • Particularly useful for studying interactions in live cells

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant Nat8b on sensor chips

    • Measure binding kinetics with potential interacting proteins

    • Determine association and dissociation constants

  • Viral protein interaction studies:

    • Based on NAT8's interaction with viral proteins (2B, 3AB, and 3C)

    • Investigate whether Nat8b similarly interacts with viral components

    • Use co-expression systems followed by co-IP or proximity labeling

What are emerging research areas for Nat8b beyond its established role in ER acetylation?

Based on current findings, several promising research directions for Nat8b include:

  • Viral infection and host defense:

    • Investigate whether Nat8b, like NAT8, plays a role in viral replication

    • Explore potential therapeutic applications targeting Nat8b in viral infections

    • Study how acetylation of viral proteins affects their function and stability

  • Neurological development and disorders:

    • Further elucidate the role of ER acetylation in neuron morphology and function

    • Investigate connections between Nat8b and psychiatric disorders through mouse models

    • Explore compensatory mechanisms in humans with inactive NAT8B

  • Cellular stress response:

    • Examine how Nat8b activity changes under ER stress conditions

    • Investigate whether Nat8b acetylation affects the unfolded protein response

    • Study potential roles in proteostasis and protein quality control

  • Comparative enzymology:

    • Conduct detailed structural studies comparing Nat8b with other acetyltransferases

    • Investigate the evolutionary significance of gene duplication events

    • Develop species-specific inhibitors for research applications

  • Automated experimental systems:

    • Implement design-build-test-learn (DBTL) cycles for studying Nat8b function

    • Apply artificial intelligence to predict Nat8b substrates and interactions

    • Develop high-throughput screening methods for Nat8b modulators

How can computational approaches advance our understanding of Nat8b function and regulation?

Computational biology offers powerful tools for advancing Nat8b research:

  • Structural modeling and dynamics:

    • Generate homology models based on related acetyltransferases

    • Perform molecular dynamics simulations to understand substrate binding

    • Predict post-translational modifications that regulate Nat8b activity

  • Systems biology approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data to place Nat8b in cellular networks

    • Model the impact of Nat8b acetylation on secretory pathway efficiency

    • Create predictive models of acetylation targets based on sequence motifs

  • Evolutionary analysis:

    • Further analyze the patterns of gene duplication and recombination

    • Investigate selective pressures on Nat8 family genes across species

    • Identify functional domains through comparative sequence analysis

  • Machine learning applications:

    • Develop algorithms to predict Nat8b substrates based on protein features

    • Apply natural language processing to extract Nat8b-related findings from literature

    • Create neural networks that predict phenotypic outcomes of Nat8b manipulation

  • Automated experimental design:

    • Implement the design-build-test-learn (DBTL) cycle approach

    • Use computational models to optimize parameters for Nat8b expression and activity

    • Apply artificial intelligence to interpret experimental results and guide future experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.