N-acetyltransferase 8B (Nat8b), also known as ATase1, is an enzyme involved in Nε-lysine acetylation of nascent proteins within the lumen of the endoplasmic reticulum. This acetylation process serves as a quality control mechanism that ensures protein homeostasis (proteostasis) within the secretory pathway . Nat8b is one of two ER-membrane bound acetyltransferases, alongside ATase2/NAT8, that catalyze this reaction. These enzymes work in tandem with AT-1/SLC33A1, an ER-membrane antiporter that moves acetyl-CoA from the cytosol into the lumen of the ER in exchange for free CoA .
The gene status of Nat8b varies between species. In humans, NAT8B resulted from duplication of the NAT8 gene in the primate lineage, but contains a premature stop codon at position 16, rendering it inactive . In contrast, mouse Nat8b appears to be functional, though it is sometimes referenced as Nat8b-ps (pseudogene) in some databases . This species difference makes the recombinant mouse form particularly valuable for studying the biological functions of this acetyltransferase.
Recombinant Mouse Probable N-acetyltransferase 8B is produced as a full-length protein consisting of 232 amino acids. The complete amino acid sequence is:
MPRFEAQKSSMVPYHIRQYQDSDHKRVVDVFTTGAEEYIPSTFRHVLRLPRTFLLLLGVP LALVLVSGSWILAVICIFFLLLLLRLLARQPWKEYVAKCLQTYMVDITKSYLNVHGACFW VAESGGQVVGIVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSY SDVVLETSTLQQGAMTLYLGMGFKKTGQYFKSMFWRLVDICFIQLNYSFPSA
Structurally, Nat8b is a type-II membrane protein with its catalytic domain facing the ER lumen . This orientation is crucial for its function in acetylating nascent proteins within the ER.
Nat8b functions as an acetyltransferase within the ER lumen, where it catalyzes the Nε-lysine acetylation of nascent proteins. This post-translational modification plays a crucial role in protein quality control within the secretory pathway . The acetylation machinery, including Nat8b, is particularly important in highly metabolic and polarized cells that rely heavily on an efficient secretory pathway, such as neurons .
Recent research has demonstrated that reducing ER acetylation can induce reticulophagy (ER-specific autophagy), increase ER turnover, and alleviate proteotoxic states associated with various diseases . This suggests that modulating Nat8b activity could have therapeutic implications for conditions characterized by protein misfolding and aggregation.
Studies using knockout mice have revealed that Nat8b (ATase1) and NAT8 (ATase2) play different roles in the regulation of reticulophagy and macroautophagy . Importantly, knockout of Nat8b alone results in activation of reticulophagy and rescue of the proteotoxic state associated with Alzheimer's disease . Furthermore, loss of either Nat8b or NAT8 results in widespread adaptive changes in the cell acetylome and acetyl-CoA metabolism, highlighting their importance in cellular homeostasis.
These findings emphasize the divergent roles of Nat8b and NAT8 in cellular biology and suggest that Nat8b could be a valid translational target for diseases characterized by toxic protein aggregation in the secretory pathway .
Several chemicals have been found to affect Nat8b expression, as documented in the Rat Genome Database. The table below summarizes some of these interactions:
| Chemical Compound | Effect on Nat8b | Evidence Type |
|---|---|---|
| 2,2',4,4'-Tetrabromodiphenyl ether | Decreases expression | Experimental |
| 2,3,7,8-tetrachlorodibenzodioxine | Decreases expression | Experimental |
| 3-chloropropane-1,2-diol | Decreases expression | Experimental |
| 6-propyl-2-thiouracil | Decreases expression | Experimental |
| Bisphenol A | Increases expression | Experimental |
| Aflatoxin B1 | Increases expression | ISO (based on human NAT8B) |
| Aflatoxin B1 | Decreases methylation | ISO (based on human NAT8B) |
Table 2: Chemical compounds affecting Nat8b expression and methylation
These chemical interactions provide insights into potential regulatory mechanisms of Nat8b expression and suggest that environmental factors may influence ER acetylation processes through modulation of Nat8b levels.
The Nε-lysine acetylation catalyzed by Nat8b appears to be functionally significant for protein homeostasis. Research has shown that dysfunctional ER acetylation, as caused by loss-of-function mutations or gene duplication events, is associated with severe inherited diseases . This underscores the importance of proper ER acetylation in maintaining cellular health and function.
The finding that knockout of Nat8b can rescue the proteotoxic state associated with Alzheimer's disease suggests that this protein may be a valuable target for neurodegenerative disease research . Recombinant Mouse Nat8b provides researchers with a tool to investigate the mechanisms by which ER acetylation affects protein aggregation and neurodegeneration.
Studies using Nat8b knockout mice have shown that reducing ER acetylation through elimination of Nat8b can induce reticulophagy, increase ER turnover, and alleviate proteotoxic states . These findings suggest that inhibition of Nat8b could potentially be developed as a therapeutic strategy for conditions characterized by protein misfolding and aggregation in the secretory pathway.
While much of the research on acetyltransferases has focused on NAT8 rather than Nat8b, studies have shown that ER-resident acetyltransferases can influence viral replication. Research has identified NAT8 as a host factor for enterovirus 71 (EV71) infection, promoting viral replication in an acetyltransferase-activity-dependent manner .
The findings with NAT8 raise the possibility that Nat8b might also play roles in host-virus interactions, though more specific studies on Nat8b are needed. Recombinant Mouse Nat8b provides a valuable tool for investigating these potential interactions.
Given that human NAT8B is considered an inactive gene due to a premature stop codon , while mouse Nat8b appears to be functional, comparative studies between the two can provide insights into species-specific differences in ER acetylation mechanisms. The recombinant mouse form allows researchers to study the functional aspects of this acetyltransferase that may not be accessible through studies of the human ortholog.
Recombinant Mouse Nat8b can be used in various experimental applications, including:
SDS-PAGE analysis for protein characterization
Enzymatic activity assays to measure acetyltransferase function
Protein-protein interaction studies to identify binding partners
In vitro acetylation assays to identify potential substrates
Structural studies to elucidate the protein's catalytic mechanism
These applications provide valuable insights into the functional properties of Nat8b and its role in ER acetylation processes.
Recombinant Mouse Probable N-acetyltransferase 8B (Nat8b) exhibits lysine N-acetyltransferase activity, catalyzing the N6-acetylation of peptidyl-lysine residues in various proteins. This activity may regulate apoptosis via acetylation and expression modulation of PROM1. Additionally, Nat8b may regulate amyloid beta-peptide secretion through the acetylation and expression regulation of BACE1 in neurons.
STRING: 10090.ENSMUSP00000124315
Nat8b (also known as ATase1) is an endoplasmic reticulum (ER) acetyltransferase that participates in Nε-lysine acetylation of nascent glycoproteins within the ER lumen. It functions alongside AT-1 (acetyl-CoA transporter) and ATase2/NAT8 as part of the ER acetylation machinery . This acetylation process regulates the efficiency of the secretory pathway, which is particularly crucial in highly metabolic and polarized cells such as neurons .
Research has demonstrated that the ER acetylation machinery plays a significant role in neurophysiology, with dysregulation associated with neurological conditions including autism spectrum disorder, intellectual disability, and sensory neuropathies .
While Nat8b (ATase1) and Nat8 (ATase2) share approximately 90% sequence identity and similar enzymatic properties, they exhibit important differences in regulation and function :
| Characteristic | Nat8b/ATase1 | Nat8/ATase2 |
|---|---|---|
| Post-translational regulation | Regulated via acetylation | Not regulated via acetylation |
| Gene expression regulation | Contains specific binding sites for neuron-related transcription factors (CREB, c-FOS, c-JUN) | Similar binding sites but additional transcriptional regulation modes |
| Human functionality | Inactive in humans due to premature stop codon at position 16 | Active in humans |
| Evolutionary conservation | Less conserved across species | More conserved across species |
Nat8 has also been identified as a functional enzyme involved in mercapturic acid formation, while Nat8b has been confirmed as an inactive gene in humans .
Nat8b is a type-II membrane protein localized to the endoplasmic reticulum (ER) lumen . The protein contains:
A relatively conserved region of approximately 30 amino acids
A hydrophobic stretch of ~30 residues responsible for membrane attachment
A C-terminal region of about 120 residues that aligns with other N-acetyltransferases and likely includes most of the catalytic site
This ER localization is critical for its function in acetylating nascent glycoproteins as they transit through the secretory pathway. The membrane attachment domain ensures proper positioning within the ER to access both substrates (nascent proteins) and cofactors (acetyl-CoA provided by AT-1 transporter) .
When designing experiments with recombinant mouse Nat8b, researchers should consider:
Protein stability and storage conditions: Recombinant Nat8b should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses. Avoid repeated freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week .
Reconstitution protocol:
Species differences: Mouse Nat8b is functional, while human NAT8B contains a premature stop codon. This critical difference must be accounted for when designing translational studies .
Expression systems: E. coli has been successfully used for recombinant expression of full-length mouse Nat8b (1-232 amino acids) with N-terminal His-tag .
Potential cytotoxicity: Overexpression of NAT8 has been shown to lead to cell death in transfected HEK293T cells, with significant effects on lactate dehydrogenase release. Similar effects might occur with Nat8b and should be monitored in experimental designs .
Based on established knockout methodologies, researchers should implement the following approach :
Targeting vector construction:
Obtain bacterial artificial chromosome (BAC) clones containing the entire Nat8b gene
Construct a knockout targeting vector containing a floxed Neo selection cassette using traditional cloning techniques and recombineering
Include appropriate flanking sequences for homologous recombination
ES cell targeting:
Linearize the completed targeting vector and introduce by electroporation into murine ES cells (e.g., JM8A3 C57BL/6N-derived cells)
Select cells that integrated the targeting vector using G418
Use gancyclovir (GANC) to select against clones containing the HSV-TK cassette
Verify clone integrity by Southern blot and DNA sequence analysis
Confirm euploidy through chromosome counting
Chimera generation and breeding:
Microinject verified ES cells into C57BL/6 blastocysts
Mate highly chimeric male founders with C57BL/6 females
Genotype F1 pups to identify those carrying the gene-targeted allele
Remove the Neo cassette by breeding with Cre-expressing mice
Validation primers:
To study Nat8b's enzymatic activity in vitro, researchers should consider the following approaches:
Acetyltransferase assays:
Use recombinant full-length mouse Nat8b protein (His-tagged) expressed in E. coli
Set up reactions containing purified Nat8b, acetyl-CoA as donor, and appropriate substrate proteins
Measure transfer of acetyl groups to lysine residues using:
Radioactive assays with [14C]-acetyl-CoA
Antibody-based detection of acetylated lysines
Mass spectrometry to identify specific acetylated residues
Structure-function analyses:
Generate mutations in catalytic residues to assess their importance (based on homology with NAT8)
Create domain-swapping constructs between Nat8b and NAT8 to determine functional regions
Substrate identification:
Perform in vitro acetylation reactions with potential substrates followed by mass spectrometry
Use proximity labeling approaches to identify interacting proteins in cellular contexts
Controls:
Critical differences between human NAT8B and mouse Nat8b pose important considerations for translational research:
| Feature | Human NAT8B | Mouse Nat8b |
|---|---|---|
| Functionality | Inactive (premature stop codon at position 16) | Functional protein |
| Expression | Transcribed but produces a truncated protein | Produces full-length functional protein (232 aa) |
| Sequence variation | Rare instances of serine at position 16 | No premature stop codon |
| Gene duplication | One of two NAT8 homologues in humans | One of multiple NAT8 homologs in mice (which has eight) |
These differences necessitate caution when extrapolating findings from mouse models to human contexts. Specifically:
Mouse models using Nat8b may not directly translate to human disease contexts where NAT8B is naturally inactive
Any observed phenotypes from Nat8b manipulation in mice would likely be mediated by NAT8 (ATase2) in humans
Compensatory mechanisms may exist in humans that accommodate for the non-functional NAT8B
The evolutionary analysis of the NAT8 gene family reveals fascinating patterns :
Gene duplication patterns:
All vertebrate genomes contain homologues of NAT8L and NAT8
Only one NAT8L gene per genome across all vertebrates
Variable numbers of NAT8 homologues:
One (dog and macaque)
Two (human, Pongo, horse, and Danio rerio)
Six (Monodelphis)
Seven (rat)
Eight (mice)
Genomic organization:
Multiple NAT8 homologues appear as tandemly repeated genes in one genomic location
This suggests the NAT8 gene underwent several duplication events in specific lineages
NAT8L, though structurally related, did not undergo similar duplication events
Sequence conservation:
NAT8 sequences show much lower conservation than NAT8L sequences
Example: Mouse and rat NAT8L show 100% identity in aligned regions
In contrast, the closest NAT8 homologues of mouse and rat (CML4) show only 90% identity
Evidence of recombination:
Nat8b/ATase1 plays crucial roles in neuronal function through several mechanisms :
Regulation of secretory pathway efficiency:
Acetylation of nascent glycoproteins influences their processing and trafficking
This is particularly important in highly polarized neurons with extensive secretory demands
Neuronal morphology regulation:
The ER acetylation machinery influences neuron morphology
Altered acetylation patterns can affect neurite outgrowth and synapse formation
Transcriptional regulation:
Nat8b promoter contains functional binding sites for neuron-related transcription factors:
cAMP response element-binding protein (CREB)
Immediate early genes c-FOS and c-JUN
This suggests activity-dependent regulation of Nat8b expression
Implications for disorders:
Recent research has uncovered a novel function of NAT8 in viral infections, which may provide insights for Nat8b research :
Viral replication promotion:
NAT8 has been identified as a host factor for Enterovirus 71 (EV71) infection
Inhibiting NAT8 (via CRISPR or small compounds) significantly suppresses EV71 infection
Mechanism of action:
NAT8 promotes viral replication in an acetyltransferase-activity-dependent manner
It interacts with EV71 proteins (2B, 3AB, and 3C) and increases their stability
Research implications for Nat8b:
Given the high sequence similarity between NAT8 and Nat8b (90%), investigating whether Nat8b has similar effects on viral replication could be valuable
Researchers should investigate:
When encountering contradictory results in Nat8b research, consider these methodological approaches:
Systematic validation across systems:
Test findings in multiple cell lines and primary cultures
Validate in vivo results across different mouse strains
Compare results from different recombinant protein sources
Technical considerations:
Address species-specific differences:
Acknowledge human NAT8B inactivity when interpreting translational results
Consider compensatory mechanisms in NAT8B-deficient organisms
Experimental design controls:
Include both positive controls (known functional enzymes) and negative controls
Use mutant variants (catalytically inactive) as additional controls
Document experimental conditions thoroughly to facilitate replication
Reporting practices:
For optimal handling and storage of recombinant mouse Nat8b protein, researchers should follow these guidelines :
Initial storage:
Store lyophilized powder at -20°C/-80°C upon receipt
Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles
Reconstitution protocol:
Briefly centrifuge vial before opening to bring contents to bottom
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add glycerol to 5-50% final concentration (50% recommended)
Aliquot for long-term storage at -20°C/-80°C
Working storage:
Keep working aliquots at 4°C for no longer than one week
Avoid repeated freezing and thawing
Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for storage
Quality control:
Understanding and manipulating Nat8b expression requires knowledge of its regulatory elements :
Key promoter elements:
The promoter region of NAT8B (human homolog) spans the transcriptional start site (+1) to 1,000 bases upstream
Contains functional binding sites for:
cAMP response element-binding protein (CREB)
Immediate early genes c-FOS and c-JUN
Additional transcription factors relevant to aging and Alzheimer's disease
Experimental manipulation techniques:
Promoter analysis tools:
Gene Promoter Miner
Jaspar
TFsitescan
PROMO
AliBaba2.1
MAPPER 2
Primer sets for promoter analysis:
| Primer Set | Forward Sequence | Reverse Sequence | Product Size |
|---|---|---|---|
| NAT8B.1 | 5'-CCAGATTCCAATGCAGGTCTT-3' | 5'-TCCCTGCACGCCTTTAC-3' | 186 bp |
| NAT8B.2 | 5'-ATGCACCAAGAAGCTGAGAG-3' | 5'-CCTTTCTAGCTGTGTGACCTTG-3' | 206 bp |
| NAT8B.3 | 5'-CTGAGCATGCACCTTCCTT-3' | 5'-CTTGGTGCATTGAGAGAGTA-3' | 219 bp |
| NAT8B.4 | 5'-CCTAGGGTTGATGATTACCAAACATCC-3' | 5'-ACTGTCCTTCCACCCAGT-3' | 181 bp |
| NAT8B.5 | 5'-AGTATCAAGTGTGCCAGGTG-3' | 5'-GTCAAAGAGCTGGGCTGTAA-3' | 190 bp |
Expression modulation:
To investigate protein-protein interactions involving Nat8b, researchers can employ these methodologies:
Co-immunoprecipitation (Co-IP):
Use anti-His tag antibodies to pull down recombinant Nat8b
Identify interacting partners through Western blotting or mass spectrometry
Include appropriate controls to verify specificity of interactions
Yeast two-hybrid screening:
Clone Nat8b as bait protein
Screen against neuronal or ER-specific prey libraries
Validate positive interactions through secondary assays
Proximity labeling approaches:
Fuse Nat8b to BioID or APEX2
Express in relevant cell types to identify proximal proteins
Analyze biotinylated proteins through streptavidin pulldown and mass spectrometry
Fluorescence resonance energy transfer (FRET):
Generate fluorescent protein fusions with Nat8b
Measure energy transfer between Nat8b and potential interacting partners
Particularly useful for studying interactions in live cells
Surface plasmon resonance (SPR):
Immobilize purified recombinant Nat8b on sensor chips
Measure binding kinetics with potential interacting proteins
Determine association and dissociation constants
Viral protein interaction studies:
Based on current findings, several promising research directions for Nat8b include:
Viral infection and host defense:
Neurological development and disorders:
Cellular stress response:
Examine how Nat8b activity changes under ER stress conditions
Investigate whether Nat8b acetylation affects the unfolded protein response
Study potential roles in proteostasis and protein quality control
Comparative enzymology:
Automated experimental systems:
Computational biology offers powerful tools for advancing Nat8b research:
Structural modeling and dynamics:
Generate homology models based on related acetyltransferases
Perform molecular dynamics simulations to understand substrate binding
Predict post-translational modifications that regulate Nat8b activity
Systems biology approaches:
Integrate transcriptomic, proteomic, and metabolomic data to place Nat8b in cellular networks
Model the impact of Nat8b acetylation on secretory pathway efficiency
Create predictive models of acetylation targets based on sequence motifs
Evolutionary analysis:
Machine learning applications:
Develop algorithms to predict Nat8b substrates based on protein features
Apply natural language processing to extract Nat8b-related findings from literature
Create neural networks that predict phenotypic outcomes of Nat8b manipulation
Automated experimental design: