Recombinant Mouse Probable N-acetyltransferase CML1 (Cml1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Cml1; Probable N-acetyltransferase CML1; Camello-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cml1
Target Protein Sequence
MVPYHIRQYQDSDHKRVVDVFTKGMEEYIPSTFRHMLMLPRTLLLLLGVPLALVLVSGSW ILAVICIFFLLLLLRLLARQPWKEYVAKCLQTDMVDITKSYLNVHGACFWVAESGGQVVG IVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSYSDVVLETSAL QQGAVTLYLGMGFKKAGQYFMSIFWRLAGICTIQLKYSFPSA
Uniprot No.

Target Background

Function

May play a role in regulating gastrulation.

Database Links

KEGG: mmu:66116

UniGene: Mm.13036

Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular identity of Recombinant Mouse Probable N-acetyltransferase CML1?

Recombinant Mouse Probable N-acetyltransferase CML1, officially named camello-like 1, is a full-length protein containing 222 amino acids. The protein is available in various recombinant forms with different tags (His, Avi, Fc) depending on experimental requirements. Full-length mouse CML1 protein is typically expressed in prokaryotic systems such as E.coli with His-tagging for purification purposes .

How does Mouse CML1 compare to its rat ortholog structurally?

Mouse CML1 consists of 222 amino acids while the rat ortholog contains 221 amino acids, suggesting high conservation with slight species-specific differences. Both proteins are classified as probable N-acetyltransferases, indicating similar enzymatic functions across species. Recombinant versions of both proteins are commercially available with various expression systems and tags to accommodate diverse research applications .

SpeciesProtein LengthCommon Expression SystemsAvailable Tags
Mouse (Mus musculus)222 amino acidsE.coliHis
Rat221 amino acidsE.coli, HEK293, Mammalian CellsHis, Avi, Fc

What expression systems yield optimal activity for recombinant Mouse CML1?

For functional studies of recombinant Mouse CML1, both prokaryotic and eukaryotic expression systems have distinct advantages. E.coli systems (as listed for product RFL8817MF) provide higher protein yields but may lack post-translational modifications. For applications requiring native protein modifications, mammalian expression systems similar to those used for rat CML1 may be more appropriate. The choice depends on the research question, with E.coli-expressed protein (full length 1-222) being suitable for structural studies and initial characterization, while mammalian-expressed protein might better reflect in vivo functionality .

What purification approaches maximize yield while preserving activity?

A multi-step purification strategy is recommended for recombinant Mouse CML1:

  • Immobilized Metal Affinity Chromatography (IMAC) utilizing the His-tag

  • Size exclusion chromatography to remove aggregates and impurities

  • Ion exchange chromatography for final polishing if necessary

For activity-sensitive applications, consider:

  • Using mild elution conditions during IMAC

  • Including stabilizing agents (glycerol, reducing agents) in all buffers

  • Minimizing freeze-thaw cycles by aliquoting the purified protein

How can researchers accurately assess N-acetyltransferase activity of Mouse CML1?

Quantitative assessment of Mouse CML1 N-acetyltransferase activity requires:

  • Spectrophotometric assay: Monitor the release of CoA-SH from acetyl-CoA using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) as a colorimetric agent

  • Radiometric assay: Using [14C]-acetyl-CoA to track acetyl group transfer to substrates

  • LC-MS/MS approach: Direct measurement of acetylated products

Essential controls include:

  • Heat-inactivated enzyme

  • Reaction without enzyme

  • Known N-acetyltransferase as positive control

  • Substrate specificity panel (multiple potential substrates)

What protocols effectively identify CML1 interaction partners?

To comprehensively characterize the Mouse CML1 interactome:

  • Affinity purification-mass spectrometry (AP-MS): Using His-tagged or Fc-tagged CML1 as bait

  • Proximity labeling: BioID or APEX2 fusion constructs expressed in relevant cell lines

  • Yeast two-hybrid screening: Using full-length CML1 or domain-specific constructs

  • Co-immunoprecipitation: With antibodies against endogenous proteins

Validation of putative interactions requires orthogonal approaches and functional studies to distinguish physiological from artifactual interactions.

How should researchers design CRISPR-Cas9 experiments to investigate CML1 function?

For CRISPR-Cas9 gene editing of Mouse CML1:

  • Guide RNA design: Target early exons to maximize disruption probability while verifying minimal off-target effects

  • Editing strategy options:

    • Complete knockout for loss-of-function studies

    • Point mutations in catalytic domains to specifically disrupt N-acetyltransferase activity

    • Knock-in of fluorescent tags for localization studies

  • Validation approaches:

    • PCR and sequencing to confirm edits

    • Western blotting to verify protein loss/modification

    • N-acetyltransferase activity assays to confirm functional consequences

What considerations are critical when investigating tissue-specific roles of CML1?

When examining tissue-specific functions of Mouse CML1:

  • Expression profiling: Utilize RNA-seq and protein expression data across different tissues to prioritize relevant systems

  • Conditional approaches: Consider tissue-specific Cre-loxP systems for knockout studies

  • Developmental timing: Assess expression throughout development to identify critical windows

  • Compensatory mechanisms: Investigate potential upregulation of related N-acetyltransferases that may mask phenotypes

How can researchers diagnose and resolve issues with recombinant CML1 activity?

When facing inconsistent activity of recombinant Mouse CML1:

  • Protein quality assessment:

    • SDS-PAGE for purity evaluation

    • Circular dichroism for secondary structure confirmation

    • Dynamic light scattering for aggregation analysis

  • Buffer optimization:

    • Screen pH ranges (typically 7.0-8.0)

    • Test various salt concentrations (50-150 mM NaCl)

    • Evaluate cofactor requirements (potential metal ions)

  • Storage conditions:

    • Store at -80°C in small aliquots

    • Include 10-20% glycerol as cryoprotectant

    • Add reducing agents if necessary

  • Expression system evaluation:

    • Compare activity between E.coli and mammalian-expressed versions

    • Assess if tag position affects activity

What approaches help resolve contradictory data when analyzing CML1 function?

When facing conflicting results in CML1 functional studies:

  • Systematic methodological evaluation:

    • Compare assay conditions between studies

    • Assess protein quality metrics (purity, stability, activity)

    • Verify antibody specificity with appropriate controls

  • Biological context considerations:

    • Cell/tissue type differences

    • Species-specific differences (mouse vs. rat)

    • Developmental stage variations

  • Experimental design improvements:

    • Include both gain- and loss-of-function approaches

    • Utilize dose-response studies rather than single-point experiments

    • Implement time-course analyses to capture kinetic differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.