Recombinant Mouse Probable N-acetyltransferase CML3 (Cml3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mouse Probable N-acetyltransferase CML3, also known as Cml3, is a protein that belongs to the N-acetyltransferase family of enzymes . N-acetyltransferases are involved in catalyzing the transfer of an acetyl group from acetyl-CoA to various substrates . Cml3 is a protein that is found in mice and is encoded by the gene Cml3 . The protein is also known as Camello-like protein 3 .

Production and Availability

Recombinant Mouse Probable N-acetyltransferase CML3 is produced as a recombinant protein in genetically modified E. coli . It is available in lyophilized form from a 0.2 µm filtered solution containing 0.1% Trifluoroacetic Acid (TFA) .

Applications and Research Use

Recombinant Mouse Probable N-acetyltransferase CML3 has potential applications in various research areas, including:

  1. ELISA assays Recombinant Mouse Probable N-acetyltransferase CML3 can be used in ELISA assays .

  2. Studying protein interactions Recombinant proteins are useful tools for investigating protein-protein interactions .

  3. Investigating enzymatic activity Recombinant N-acetyltransferases can be used to study their enzymatic activity and substrate specificity .

  4. Cellular function MCP-3 regulates macrophage function during inflammation and metastasis .

Quality Control

Specification*Method of DeterminationAcceptance Criteria
PurityReducing and Non-Reducing SDS PAGE≥ 95%
EndotoxinKinetic LAL≤ 0.1 EU/µg
Biological Activity (ED 50)No data availableNo data available

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, and the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
Nat8f3; Cml3; N-acetyltransferase family 8 member 3; Camello-like protein 3; N-acetyltransferase CML3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cml3
Target Protein Sequence
MAPYHIRKYQDSDHRSVVDLFRRGMEEHIPATFRHMLLLPRTLLLLLGVPLTLFLASGSW LLVLLSILTLFLSLWFLAKYTWEKHVMNCLHTDMADITRTYLSSHSSCFWVAESRGQTVG MVAARPVKDPLLQKKQLQLLHLSVSLQHRREGLGKAMVRTVLQFAQMQGFSEVVLSTSML QYAALALYQGMGFQKTGETFYTYLSRLRKSPMINLKYSLTSREGDL
Uniprot No.

Target Background

Function
Exhibits in vitro histone acetyltransferase activity, specifically targeting histone H4.
Database Links
Protein Families
Camello family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cytoplasm.

Q&A

What is Mouse Probable N-acetyltransferase CML3 and what are its primary functions?

Mouse Probable N-acetyltransferase CML3 belongs to the family of arylamine N-acetyltransferases that catalyze the transfer of acetyl groups from acetyl-CoA to various arylamine substrates. These enzymes play critical roles in the metabolism of xenobiotics, particularly aromatic amines and hydrazines. In experimental systems, N-acetyltransferases have demonstrated significant activity toward substrates like sulfamethazine and p-aminobenzoic acid, with activity levels typically measured in partially purified cytosolic preparations. The activity of these enzymes appears to correlate with sensitivity to certain nitroaromatic compounds, suggesting their involvement in activating these compounds to toxic metabolites .

How does CML3 expression vary across different mouse tissues and cell types?

While specific expression patterns of CML3 are not directly addressed in the provided sources, research on N-acetyltransferase activities shows significant variation across different cell lines. In mouse models, hepatoma cell lines like BW1J have demonstrated low N-acetyltransferase activity (less than 15 nmol/min × mg protein), while other mammalian cell lines such as hamster V79 and rat hepatoma H4IIEC3G exhibit higher activities ranging from 120-270 nmol/min × mg protein . This suggests that expression and activity levels of N-acetyltransferases like CML3 are likely tissue-specific and may be regulated by cellular differentiation and metabolic state.

What are the structural characteristics of Mouse Probable N-acetyltransferase CML3?

Mouse Probable N-acetyltransferase CML3 shares structural characteristics with other members of the N-acetyltransferase family. Recombinant proteins in this category are typically produced with tags (such as His-tags) to facilitate purification and characterization. For instance, other mouse recombinant proteins like YM1/Chitinase 3-like 3 are produced with a C-terminal 6-His tag spanning specific amino acid sequences (e.g., Met1-Tyr398) . By analogy, recombinant CML3 would likely be designed with similar structural modifications to enhance purification efficiency while preserving enzymatic function.

How can Mouse N-acetyltransferase CML3 be used to study xenobiotic metabolism in research models?

N-acetyltransferases play a critical role in xenobiotic metabolism, particularly in the activation or detoxification of aromatic amines and nitroaromatic compounds. Researchers can utilize recombinant CML3 to investigate the metabolic pathways of various compounds in controlled experimental settings. Based on available data, N-acetyltransferase activities correlate with cellular sensitivity to compounds like 1,6-dinitropyrene (1,6-DNP), suggesting that acetylation is an essential step in activating certain compounds to toxic products . Experimental designs should include:

  • Comparative metabolism studies using cell lines with varying CML3 expression levels

  • Correlation analyses between enzyme activity and cellular sensitivity to xenobiotics

  • Inhibitor studies to confirm specificity of CML3-mediated effects

This approach provides valuable insights into detoxification mechanisms and potential targets for therapeutic intervention.

What is the relationship between N-acetyltransferase activity and cellular sensitivity to nitroaromatic compounds?

Research has demonstrated a noteworthy correlation between N-acetyltransferase activity and cellular sensitivity to nitroaromatic compounds, particularly 1,6-dinitropyrene (1,6-DNP). Cell lines exhibiting high transferase activities (120-270 nmol/min × mg protein), such as hamster V79, BHK, rat hepatoma H4IIEC3G, and fibroblast 208F, show increased sensitivity to 1,6-DNP. Conversely, human lung cells NCI-H322 and mouse/rat hepatoma cells BW1J and H5, which possess low or undetectable transferase activity (<15 nmol/min × mg protein), display resistance to 1,6-DNP toxicity .

How does CML3 activity compare to other mouse N-acetyltransferases in experimental systems?

The mouse genome encodes multiple N-acetyltransferases that may exhibit distinct substrate preferences and tissue expression patterns. When designing experiments to study CML3 specifically, researchers should consider:

  • Substrate specificity profiles using common acetyl acceptors such as sulfamethazine and p-aminobenzoic acid

  • Kinetic parameters (Km, Vmax) comparison across different mouse N-acetyltransferases

  • Inhibition profiles using selective inhibitors

This comparative approach allows researchers to distinguish CML3 activity from other N-acetyltransferases and establish its unique contribution to xenobiotic metabolism in mouse models.

What are the optimal conditions for expressing and purifying recombinant Mouse N-acetyltransferase CML3?

Based on established protocols for similar recombinant proteins, optimal expression and purification of Mouse N-acetyltransferase CML3 would typically involve:

Expression System Selection:

  • Bacterial systems (E. coli) for high yield but potential folding issues

  • Mammalian cell lines for proper post-translational modifications

  • Insect cell expression systems for balance between yield and proper folding

Purification Strategy:

  • Affinity chromatography using His-tag (if the recombinant protein includes a 6-His tag)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography for final polishing

Buffer Optimization:

  • pH range typically 7.2-8.0 for stability

  • Addition of reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

  • Glycerol (10-20%) for storage stability

The specific purification protocol should be optimized based on the expression system and the intended experimental applications.

What enzymatic assays are recommended for measuring CML3 activity?

For quantifying N-acetyltransferase CML3 activity, the following assays are recommended based on established protocols for N-acetyltransferases:

Spectrophotometric Assay:

  • Measure acetylation of sulfamethazine or p-aminobenzoic acid

  • Monitor formation of acetylated products at appropriate wavelengths

  • Activity typically expressed as nmol/min × mg protein

HPLC-Based Assay:

  • Separation and quantification of acetylated products

  • Higher sensitivity and specificity than spectrophotometric methods

  • Allows for multiple substrate analysis in a single run

Table 1: Comparison of Assay Methods for N-acetyltransferase Activity

Assay MethodSensitivityThroughputSpecial EquipmentKey Advantages
SpectrophotometricModerateHighSpectrophotometerRapid, simple setup
HPLCHighModerateHPLC systemHigher specificity, multiple substrate analysis
RadiometricVery HighLowScintillation counterHighest sensitivity, detects low activity
FluorometricHighHighFluorescence readerGood balance of sensitivity and throughput

When measuring activity in cellular systems, researchers should consider partial purification of cytosolic fractions to minimize interference from other cellular components .

How should researchers control for specificity when studying CML3 activity in complex biological samples?

When studying CML3 activity in complex biological samples such as tissue homogenates or cell lysates, several controls should be implemented:

  • Selective Inhibitors: Use inhibitors with differential effects on various N-acetyltransferase family members

  • Substrate Competition Studies: Compare acetylation rates with multiple substrates to establish specificity profiles

  • Immunodepletion: Remove CML3 specifically using validated antibodies to determine the contribution of CML3 to total N-acetyltransferase activity

  • Reference Cell Lines: Include control cell lines with known N-acetyltransferase expression profiles, such as those with high activity (V79, BHK) and those with low/no activity (BW1J, H5)

  • Recombinant Enzyme Controls: Use purified recombinant CML3 as a positive control to establish expected activity patterns

These approaches collectively provide robust evidence for CML3-specific activity in complex biological matrices.

How can CML3 be used to study drug metabolism and toxicity in preclinical models?

N-acetyltransferases like CML3 play crucial roles in drug metabolism pathways. Researchers can leverage CML3 in preclinical studies through:

  • Transgenic Mouse Models: Development of CML3 knockout or overexpression models to study altered drug metabolism in vivo

  • Hepatocyte Cultures: Primary or immortalized hepatocytes with varying CML3 expression levels to study metabolism of candidate drugs

  • Correlation Studies: Analyzing the relationship between CML3 activity and sensitivity to specific compounds, similar to studies with 1,6-DNP where a correlation was observed between N-acetyltransferase activity and toxicity in most cell lines

  • Metabolite Profiling: Identifying acetylated metabolites of drug candidates to predict potential toxicity or altered pharmacokinetics

These approaches provide valuable insights into drug metabolism pathways and potential toxicity mechanisms before clinical trials.

What are the implications of CML3 polymorphisms for personalized medicine approaches in mouse models?

While specific information on CML3 polymorphisms is not provided in the search results, N-acetyltransferase polymorphisms in general have significant implications for personalized medicine approaches. In mouse models, researchers can:

  • Create transgenic mice expressing variant forms of CML3 to study altered drug metabolism

  • Evaluate strain-specific differences in CML3 activity and correlate with drug sensitivity

  • Develop computational models predicting metabolism based on CML3 variants

This research direction allows for translational studies that may inform human precision medicine approaches, particularly for drugs metabolized by N-acetyltransferases.

How does CML3 interact with other phase I and phase II drug-metabolizing enzymes in xenobiotic biotransformation?

N-acetyltransferases function within a complex network of drug-metabolizing enzymes. Understanding CML3's interactions with other enzymes requires:

  • Sequential Metabolism Studies: Analyzing how compounds processed by CML3 are further metabolized by other phase II enzymes

  • Enzyme Inhibition Studies: Determining whether products of CML3-mediated acetylation inhibit or induce other metabolic enzymes

  • Integrated Pathway Analysis: Mapping complete metabolic pathways involving multiple enzymes, including CML3

Research suggests that acetylation by N-acetyltransferases can be an essential step in activating compounds like 1,6-dinitropyrene to toxic products , indicating that CML3 may function in concert with other enzymes to determine the ultimate biological effects of xenobiotics.

What are common challenges in maintaining enzyme activity during purification of recombinant CML3?

Researchers often encounter several challenges when purifying recombinant N-acetyltransferases like CML3:

  • Protein Stability: N-acetyltransferases may lose activity during purification due to oxidation of critical cysteine residues or structural instability

  • Cofactor Requirements: Ensure presence of necessary cofactors in purification buffers

  • Temperature Sensitivity: Maintain appropriate temperature conditions throughout purification process

Recommended Solutions:

  • Add reducing agents (DTT, β-mercaptoethanol) to all buffers

  • Include glycerol (10-20%) to stabilize protein structure

  • Consider rapid purification protocols to minimize time at room temperature

  • Validate activity at each purification step

How can researchers address variability in N-acetyltransferase activity across different experimental systems?

Variability in N-acetyltransferase activity is a common challenge, as evidenced by the wide range of activities observed across different cell lines (from <15 to 270 nmol/min × mg protein) . To address this variability:

  • Standardized Assay Conditions: Establish consistent protocols for enzyme preparation and activity measurement

  • Internal Controls: Include reference cell lines with known activity levels in each experimental batch

  • Normalization Strategies: Consider normalizing activity to protein concentration, cell number, or activity of a housekeeping enzyme

  • Multi-Substrate Testing: Measure activity with multiple substrates to obtain a more comprehensive activity profile

Table 2: Factors Contributing to Variability in N-acetyltransferase Activity

FactorImpactMitigation Strategy
Cell Culture ConditionsMedium composition can affect enzyme expressionStandardize media and supplements
Passage NumberHigher passages may alter enzyme expressionUse low passage cells, document passage number
Purification MethodDifferent methods yield varying purity and activityStandardize purification protocol
Storage ConditionsFreeze-thaw cycles reduce activityAliquot enzymes, avoid repeated freeze-thaw
Assay ComponentsBuffer composition affects enzyme kineticsUse consistent buffer systems

What quality control measures should be implemented when working with recombinant CML3?

To ensure reproducible results with recombinant CML3, implement the following quality control measures:

  • Purity Assessment:

    • SDS-PAGE analysis (>95% purity recommended)

    • Western blot confirmation of identity

  • Activity Verification:

    • Specific activity determination with reference substrates

    • Comparison to historical values or literature standards

  • Stability Testing:

    • Activity retention after storage at different temperatures

    • Freeze-thaw stability assessment

  • Batch Consistency:

    • Lot-to-lot comparison of activity and purity

    • Certificate of analysis for each preparation

  • Contaminant Testing:

    • Endotoxin testing for cell-based applications

    • Absence of proteolytic activity

These measures ensure that experimental outcomes reflect true biological effects rather than artifacts of variable enzyme quality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.