Recombinant Mouse Probable N-acetyltransferase CML5 (Cml5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cml5; Probable N-acetyltransferase CML5; Camello-like protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cml5
Target Protein Sequence
MAPYQIRQYQERDYKLVVGLFSRGMMEHIPAAFRYTLLLPQTLLFLFVMPLTIVLVFGSW LLAVICIFFLLLLLRLLAGQPFKDYVAQCLQTDMADITRSYLNAHGSFWVAESGGLVVGT VGGLPVKDPPLGRKQMQLFHLSVSSQHRGQGIAKALVRTVFQFARDQGYSDVVLETSVIQ QSAITLYEAMGFQRTGKYSEISIIKWLITFSIIHFTYSFPSTQKHEL
Uniprot No.

Target Background

Function
Plays a potential regulatory role in gastrulation.
Database Links
Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Mouse Cml5 and how does it affect experimental design?

Mouse Cml5 (camello-like protein 5) is a 227 amino acid multi-pass membrane protein containing one N-acetyltransferase domain. It belongs to the camello protein family, which shares sequence similarities with Xenopus camello . The membrane-embedded nature of Cml5 presents specific challenges for recombinant production and requires careful consideration of detergent selection during solubilization.

For optimal experimental design, researchers should consider:

  • The presence of multiple transmembrane domains when designing expression constructs

  • Including affinity tags positioned to avoid interference with the N-acetyltransferase domain

  • Employing mammalian expression systems (such as HEK293) to ensure proper folding and post-translational modifications

  • Implementing detergent screening protocols similar to those used for other membrane-bound N-acetyltransferases

What expression systems are most effective for producing functional recombinant Mouse Cml5?

Based on successful strategies used for other recombinant mouse proteins, several expression systems may be appropriate:

Expression SystemAdvantagesLimitationsRecommended for Cml5
HEK293Proper folding, mammalian PTMs, high yield for membrane proteinsHigher cost, longer production timeHighly recommended for functional studies
E. coliCost-effective, rapid production, high yieldLimited PTMs, inclusion body formation commonSuitable for domain studies only
Insect cellsIntermediate complexity PTMs, good for membrane proteinsGlycosylation patterns differ from mammalsViable alternative to HEK293

For functional studies, HEK293 cells appear most suitable, as demonstrated with other mouse recombinant proteins like Lrp5 . For structural studies or antibody production, bacterial systems may be sufficient if proper refolding protocols are implemented.

What are the optimal purification strategies for maintaining Cml5 N-acetyltransferase activity?

Purification of functional Cml5 requires careful consideration of its membrane protein nature and enzymatic activity:

  • Initial solubilization using mild detergents (DDM, LMNG, or digitonin)

  • Affinity chromatography using His-tag (similar to approaches for mouse C5a )

  • Size exclusion chromatography in detergent micelles

  • Activity assessment at each purification step using specific N-acetyltransferase assays

Maintaining enzyme stability is critical—consider including glycerol (10-15%) and reducing agents in all buffers. Temperature sensitivity should be evaluated, with operations typically performed at 4°C. If using a His-tag approach (commonly employed for recombinant proteins), ensure the tag position doesn't interfere with the catalytic domain of Cml5.

How can researchers accurately determine the enzymatic activity of purified recombinant Cml5?

Assessing N-acetyltransferase activity requires:

  • Substrate selection: Based on homology with other camello family members, potential substrates include cell surface glycoproteins and extracellular matrix components

  • Activity assay development:

    • Colorimetric detection of CoA release using DTNB (Ellman's reagent)

    • HPLC analysis of acetylated products

    • Mass spectrometric identification of acetylated targets

  • Kinetic parameter determination:

    • Km, Vmax, and kcat values under varying pH and temperature conditions

    • Inhibition studies to characterize active site properties

A comprehensive activity profile should include substrate specificity, optimal reaction conditions, and cofactor requirements. Comparative analysis with other N-acetyltransferases can provide valuable insights into Cml5's unique catalytic properties.

What are the established and potential roles of Cml5 in developmental biology research?

Cml5 has been implicated in gastrulation regulation, similar to other camello family proteins . Research applications may include:

  • Developmental biology studies:

    • Embryonic expression pattern analysis using in situ hybridization

    • Functional knockout/knockdown studies to assess phenotypic changes

    • Rescue experiments with recombinant Cml5 to validate function

  • Cell surface modification research:

    • Identification of specific substrates modified during development

    • Analysis of how Cml5-mediated acetylation affects cell adhesion and migration

    • Time-course studies of Cml5 activity during key developmental transitions

Given that Xenopus camello influences gastrulation movements by modifying cell surface and extracellular matrix proteins , mouse Cml5 may serve similar functions in mammalian development, making it valuable for comparative evolutionary studies of morphogenesis mechanisms.

How can recombinant Cml5 be utilized to investigate its potential role in cell signaling pathways?

Advanced research applications may include:

  • Proteomic approaches:

    • Identification of acetylation targets using recombinant Cml5 and mass spectrometry

    • Comparison of wild-type and catalytically dead Cml5 mutants

    • Differential protein acetylation profiling across developmental stages

  • Cell signaling studies:

    • Analysis of how Cml5-mediated acetylation affects receptor function

    • Investigation of cross-talk with other post-translational modifications

    • Temporal correlation between Cml5 activity and activation of developmental signaling pathways

  • Structural biology applications:

    • Crystallization of Cml5 alone and in complex with substrates

    • Structure-guided mutagenesis to define catalytic mechanism

    • Comparative structural analysis with other camello family members

How does Mouse Cml5 compare functionally to other members of the camello protein family?

The camello family includes Cml1, Cml2, Cml3, NAT-8, NAT-8L, and NAT-8B5 . Comparative analysis should consider:

ProteinTissue ExpressionSubcellular LocalizationKnown SubstratesDevelopmental Role
Cml5Liver, potentially lung, kidney, testisMulti-pass membrane proteinNot fully characterizedPotential role in gastrulation
Other Cml familyVariable tissue distributionPrimarily membrane-associatedVarious cell surface and ECM proteinsDevelopmental regulation
NAT-8 familyMore widespread expressionSimilar membrane topologyMore diverse substrate rangeBroader physiological functions

Functional divergence within the family likely reflects tissue-specific roles. Recombinant expression of multiple family members allows for direct comparison of:

  • Substrate preferences

  • Catalytic efficiencies

  • Inhibitor sensitivities

  • Protein-protein interaction profiles

What methodologies can distinguish Cml5 activity from other N-acetyltransferases in experimental systems?

To establish Cml5-specific activity:

  • Develop selective assays:

    • Design selective substrates based on sequence analysis and homology modeling

    • Identify Cml5-specific inhibitors through screening approaches

    • Create antibodies recognizing Cml5-specific acetylation patterns

  • Implement genetic approaches:

    • CRISPR-Cas9 knockout of Cml5 to establish baseline loss-of-function

    • Selective silencing using siRNA targeting Cml5-specific sequences

    • Complementation studies with recombinant Cml5 variants

  • Employ quantitative RT-PCR:

    • Similar to protocols established for Nat genes , design specific primers and probes

    • Align sequence regions with maximum specificity for Cml5

    • Validate specificity through appropriate controls

What are the critical parameters for designing Cml5 knockout/knockdown experiments?

When investigating Cml5 function through loss-of-function approaches:

  • CRISPR-Cas9 knockout design:

    • Target early exons to ensure complete functional disruption

    • Consider potential compensatory mechanisms from other camello family members

    • Design appropriate genotyping strategies to confirm modification

  • Conditional knockout strategies:

    • Implement tissue-specific or temporally controlled knockout systems

    • Consider embryonic lethality potential if Cml5 is critical for development

    • Use inducible systems to bypass developmental requirements

  • Validation approaches:

    • Confirm protein absence through Western blotting

    • Assess acetylation patterns of predicted substrates

    • Analyze phenotypic changes across developmental stages and tissues

How can researchers investigate the biochemical mechanisms of Cml5-substrate interactions?

Advanced mechanistic studies should consider:

  • Binding affinity determination:

    • Surface plasmon resonance (similar to techniques used for MBL-1 )

    • Isothermal titration calorimetry for thermodynamic parameters

    • Fluorescence-based binding assays with labeled substrates

  • Catalytic mechanism elucidation:

    • Pre-steady-state kinetics to identify rate-limiting steps

    • pH-rate profiles to identify critical ionizable residues

    • Solvent isotope effects to probe transition state structure

  • Structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Site-directed mutagenesis of predicted catalytic residues

    • Molecular dynamics simulations of substrate binding and catalysis

What are common challenges in obtaining enzymatically active recombinant Cml5 and how can they be addressed?

Researchers frequently encounter several challenges:

  • Low expression yields:

    • Optimize codon usage for expression host

    • Test different signal peptides to improve membrane targeting

    • Evaluate multiple affinity tags and their positions

    • Consider fusion partners to enhance solubility

  • Protein misfolding:

    • Test expression at lower temperatures (16-25°C)

    • Incorporate chaperone co-expression systems

    • Optimize induction conditions (concentration, timing)

    • Consider refolding protocols if using bacterial systems

  • Activity loss during purification:

    • Screen detergent types and concentrations

    • Include stabilizing agents (glycerol, specific lipids)

    • Minimize time between purification steps

    • Evaluate different storage conditions (-80°C, liquid nitrogen, lyophilization)

How can researchers validate that recombinant Cml5 maintains native structure and function?

Comprehensive validation strategies include:

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure

    • Thermal stability analysis using differential scanning fluorimetry

    • Limited proteolysis to assess domain folding

    • Analytical ultracentrifugation to determine oligomeric state

  • Functional validation:

    • Comparison with native Cml5 isolated from mouse tissues

    • Activity restoration in Cml5-deficient cell lines

    • Substrate specificity profile matching theoretical predictions

    • Inhibition patterns consistent with other N-acetyltransferases

  • Interaction verification:

    • Co-immunoprecipitation with known binding partners

    • Cell-based assays demonstrating expected subcellular localization

    • Confirmation of predicted post-translational modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.