Recombinant Mouse Probable palmitoyltransferase ZDHHC11 (Zdhhc11)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Innate Immunity

ZDHHC11 is a pivotal regulator of antiviral innate immune responses, particularly against DNA viruses like herpes simplex virus 1 (HSV-1):

Key Mechanisms

  • MITA/STING Pathway Activation: ZDHHC11 enhances MITA (mediator of IRF3 activation)-dependent signaling by promoting IRF3 recruitment, leading to IFN-β production .

    • Zdhhc11 −/− mice exhibit reduced serum IFN-α/β and IL-6 levels post-HSV-1 infection and higher lethality rates .

  • NF-κB Signaling: ZDHHC11 amplifies NF-κB activation by oligomerizing TRAF6, a ubiquitin ligase critical for TAK1 and IKK phosphorylation .

Experimental Evidence

Model SystemFindingsReference
Zdhhc11 −/− MEFsImpaired IL-6 and TNF-α production after IL-1β or HSV-1 stimulation
Zdhhc11 −/− BMDMsReduced Il6 and Il1b mRNA levels post-LPS or HSV-1 infection
HEK293T cellsZDHHC11 overexpression activates IFN-β and NF-κB promoters

Substrate Specificity and Interaction Partners

ZDHHC11 interacts with multiple signaling components:

Validated Substrates/Partners

ProteinRoleInteraction Mechanism
MITA (STING)Innate immune adaptorFacilitates IRF3 recruitment to MITA complexes
TRAF6E3 ubiquitin ligaseEnhances TRAF6 oligomerization and activity
IRF3Transcription factorPromotes phosphorylation and nuclear translocation

STRING Database Analysis

The STRING interaction network highlights ZDHHC11’s associations with:

  • TRAF6, TAK1, and IKKα (experimentally validated) .

  • MYC and miR-150-MYB (implicated in oncogenic pathways) .

Research Applications

Recombinant ZDHHC11 is utilized in:

Chemical Genetic Systems

A breakthrough platform maps ZDHHC11 substrates by combining mutant enzymes (e.g., ZDHHC11[M181A]) with synthetic lipid probes (e.g., 16-cPr) :

  • Probe Compatibility: Mutant ZDHHC11[M181A] selectively incorporates bumped probes (e.g., 16-cPr), enabling substrate identification via click chemistry .

  • Identified Substrates: Over 200 proteins across HEK293, MDA-MB-231, and PANC1 cells, including IFITM3 and CD151 .

Challenges and Limitations

  • Catalytic Redundancy: Palmitoyltransferase activity is partially compensated by ZDHHC1 in Zdhhc11 −/− models .

  • Context-Dependent Roles: Substrate profiles vary between cell types (e.g., cancer vs. immune cells) .

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of ZDHHC11 could modulate hyperinflammatory states or viral infections.

  • Cancer Biology: Investigate ZDHHC11’s role in NF-κB-driven malignancies (e.g., lymphoma, bladder cancer) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag.
Synonyms
Zdhhc11; Palmitoyltransferase ZDHHC11; DHHC-containing protein 10; DHHC10(z11); Zinc finger DHHC domain-containing protein 11; DHHC-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-347
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc11
Target Protein Sequence
MKEMNICGINKNWVLPEAQENNVKKFLPRPLSRVNGWSPPLHSFQAISWITYLAMSIVTF GIFIPFLPYSWKYAANIVMGGVFIFHLIVHLIAITIDPADTNVRLKKDYTQPVPAFDRSK HTHVIQNQYCHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNNCVGRRNYWFFFWSVASA AVGILGVMIILCYICIQYFVNPDELRTDPLYKEIISENTWLLFLSLWPVPVKTPIVLSIA VMALLLAIASFVMLGHLLIFHLYLITKNMSTFDYLMKTRFKKNLHPAEEKELPLQKKGDL PQEKSDNWAWPKSPPRVGSQKFPVSTLSPKSSVCFVASPPKICHSED
Uniprot No.

Target Background

Function
Recombinant Mouse Probable palmitoyltransferase ZDHHC11 (Zdhhc11) is an endoplasmic reticulum-localized palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates, participating in a wide range of cellular processes. It exhibits palmitoyltransferase activity toward NCDN and regulates NCDN association with endosome membranes through this palmitoylation. Zdhhc11 may play a role in cell proliferation. Additionally, it possesses a palmitoyltransferase activity-independent function in DNA virus-triggered and CGAS-mediated innate immune response. Zdhhc11 acts as an adapter that recruits IRF3 to STING1, promoting the activation of this key transcriptional regulator of type I interferon (IFN)-dependent immune response.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of mouse ZDHHC11 in cellular processes?

ZDHHC11 functions primarily as a palmitoyl transferase that mediates protein S-acylation, a post-translational modification critical for protein localization, stability, and function. In innate immunity, ZDHHC11 enhances MITA (also known as STING)-mediated responses against DNA viruses by facilitating the association between MITA and IRF3 . This interaction is crucial for downstream signaling leading to type I interferon production.

Additionally, ZDHHC11 positively regulates NF-κB signaling by promoting TRAF6 oligomerization and enhancing its E3 ubiquitin ligase activity, which subsequently activates TAK1 and IKK complexes . In viral defense, ZDHHC11 suppresses Zika virus infections by directly palmitoylating the viral envelope protein at Cys308, affecting viral function .

Methodologically, researchers can investigate these functions through:

  • Gene knockout/knockdown approaches in cell lines and mouse models

  • Overexpression systems coupled with reporter assays (e.g., IFN-β promoter activation)

  • Co-immunoprecipitation studies to identify interaction partners

  • Viral infection models using HSV-1 or Zika virus to assess immune response modulation

How can researchers generate and validate Zdhhc11 knockout mouse models?

Zdhhc11 knockout mice have been successfully generated and characterized for research purposes. The general strategy involves:

  • Vector Construction:

    • Design a targeting vector to disrupt the Zdhhc11 gene through homologous recombination

    • Include selection markers (e.g., neomycin resistance) for positive clone identification

  • Generation Process:

    • Electroporate the linearized targeting vector into embryonic stem cells (e.g., W4 ES cells)

    • Select positive clones using G418-containing medium

    • Inject positive ES cell clones into blastocysts (e.g., 129S6/SvEvTac)

    • Establish chimeric mice and confirm germline transmission

  • Genotyping Methods:

    • Design PCR primers spanning the targeted region and insertion site

    • Use primer combinations that distinguish wild-type and mutant alleles

    • Wild-type allele amplification typically yields a different fragment size compared to the mutant allele

  • Validation Approaches:

    • Confirm knockout at mRNA level via RT-qPCR

    • Verify protein absence using Western blot with ZDHHC11-specific antibodies

    • Assess functional defects in known ZDHHC11-dependent pathways, particularly:

      • Impaired cytokine production after HSV-1 infection

      • Reduced IRF3 phosphorylation in response to DNA virus challenge

      • Increased susceptibility to HSV-1-induced death

Zdhhc11 knockout mice exhibit phenotypes consistent with impaired innate immune responses, particularly showing lower serum cytokine levels and increased susceptibility to HSV-1 infection compared to wild-type littermates .

What methods are most effective for detecting ZDHHC11-mediated protein palmitoylation?

Several complementary approaches can be used to detect and quantify ZDHHC11-mediated protein palmitoylation:

  • Metabolic Labeling with Lipid Analogs:

    • Incorporate alkyne-tagged palmitate analogs (e.g., 17-octadecynoic acid) into cellular proteins

    • Perform copper-catalyzed alkyne-azide cycloaddition (CuAAC) to attach fluorescent reporters or affinity tags

    • Visualize palmitoylated proteins by in-gel fluorescence or enrichment followed by Western blotting

    • Compare palmitoylation levels between wild-type and ZDHHC11-deficient conditions

  • Acyl-Biotin Exchange (ABE) or Acyl-Resin-Assisted Capture (Acyl-RAC):

    • Block free thiols with N-ethylmaleimide

    • Selectively cleave thioester bonds with hydroxylamine

    • Label newly exposed thiols with biotin derivatives

    • Enrich biotinylated (previously palmitoylated) proteins using streptavidin

    • Detect specific proteins of interest by Western blotting

  • Palmitoylation Inhibition Studies:

    • Treat cells with 2-bromopalmitate (2-BP) to inhibit global palmitoylation

    • Compare substrate palmitoylation in presence/absence of inhibitor

    • Use this approach as a complementary control for ZDHHC11-specific palmitoylation events

  • Direct Detection in Purified Systems:

    • Reconstitute palmitoylation reactions using purified recombinant ZDHHC11 and substrate proteins

    • Include palmitoyl-CoA or alkyne-tagged palmitoyl-CoA analogs as acyl donors

    • Detect substrate modification using methods described above

    • Compare activity of wild-type ZDHHC11 with catalytically inactive mutants (e.g., C158S)

Each method has strengths and limitations, so combining multiple approaches provides the most reliable results for confirming authentic ZDHHC11 substrates and palmitoylation sites.

How can researchers identify and validate novel ZDHHC11 substrates?

Identifying and validating novel ZDHHC11 substrates requires a systematic multi-faceted approach:

  • Proteome-Wide Screening Methods:

    • Comparative palmitoyl-proteomics between wild-type and Zdhhc11-/- samples

    • Use chemical genetic approaches with engineered ZDHHC11 variants and complementary lipid probes

    • Employ proximity-based labeling methods (BioID, APEX) with ZDHHC11 as the bait

    • Perform co-immunoprecipitation coupled with mass spectrometry to identify interacting proteins

  • Candidate Substrate Validation Protocol:

    • Confirm physical interaction between ZDHHC11 and candidate substrate through co-immunoprecipitation

    • Demonstrate palmitoylation of the candidate using metabolic labeling or ABE assays

    • Show reduction or loss of palmitoylation in Zdhhc11-/- cells or upon ZDHHC11 knockdown

    • Reconstitute palmitoylation in Zdhhc11-/- cells by re-expressing wild-type but not catalytically inactive ZDHHC11

  • Site Identification and Mutagenesis:

    • Map palmitoylation sites using mass spectrometry of purified substrates

    • Bioinformatically predict potential palmitoylation sites in candidate proteins

    • Generate cysteine-to-serine mutations at predicted palmitoylation sites

    • Demonstrate loss of palmitoylation in mutant proteins

  • Functional Consequence Assessment:

    • Determine how palmitoylation affects substrate localization using microscopy

    • Assess impact on protein-protein interactions relevant to substrate function

    • Measure changes in substrate stability or turnover rates

    • Evaluate alterations in signaling pathway activation or protein function

The recently developed palmitoyl transferase chemical genetic system described for ZDHHC20 represents a particularly innovative approach that could be adapted for ZDHHC11 substrate mapping, enabling whole-proteome identification of direct substrates with high specificity.

How does ZDHHC11 regulate type I interferon responses against DNA viruses?

ZDHHC11 plays a critical role in regulating type I interferon responses specifically against DNA viruses through several interconnected mechanisms:

  • MITA/STING Pathway Enhancement:

    • ZDHHC11 facilitates the optimal recruitment of IRF3 to MITA/STING

    • This recruitment is critical for downstream signaling leading to interferon production

    • ZDHHC11 acts as a molecular linker connecting these key signaling components

  • Signaling Pathway Regulation:

    • In Zdhhc11-deficient cells, HSV-1-induced phosphorylation of IRF3 is markedly impaired

    • Importantly, TBK1 phosphorylation remains intact, suggesting ZDHHC11 functions downstream of TBK1 activation

    • This indicates ZDHHC11 specifically affects IRF3 activation rather than upstream signaling events

  • Virus-Specific Effects:

    • ZDHHC11 deficiency specifically impairs responses to DNA viruses (HSV-1) but not RNA viruses (SeV)

    • This specificity highlights ZDHHC11's role in DNA-sensing pathways rather than RNA-sensing mechanisms

    • Zdhhc11-/- mice show normal responses to RNA virus (EMCV) infection but impaired responses to HSV-1

  • Functional Outcomes In Vivo:

    • Zdhhc11-/- mice exhibit significantly lower serum cytokine levels after HSV-1 infection

    • These knockout mice show increased susceptibility to HSV-1-induced mortality

    • Higher HSV-1 gene transcription and viral titers are detected in the brains of Zdhhc11-/- mice

The DNA virus specificity of ZDHHC11's function suggests it plays a specialized role in DNA-sensing pathways, potentially through direct modulation of MITA/STING-dependent signaling complexes via palmitoylation of key components or through protein-protein interactions that facilitate optimal signal transduction.

What molecular mechanisms underlie ZDHHC11's role in suppressing Zika virus infection?

ZDHHC11 employs a distinct mechanism to suppress Zika virus (ZIKV) infection, focusing directly on viral protein modification rather than host immune signaling:

  • Viral Protein Targeting:

    • ZDHHC11 directly interacts with the ZIKV envelope protein and catalyzes its palmitoylation at Cys308

    • This represents a novel post-translational modification of the ZIKV envelope protein

    • The enzymatic activity of ZDHHC11 is essential for this antiviral function

  • Experimental Evidence:

    • Inhibition of global palmitoylation using 2-bromopalmitate (2-BP) enhances ZIKV infections

    • ZDHHC11 knockdown promotes ZIKV infection, confirming its protective role

    • The suppressive effect of ZDHHC11 on ZIKV is dependent on its palmitoyl transferase activity

  • Mechanism Distinction:

    • Unlike its role in DNA virus defense (enhancing immune signaling)

    • ZDHHC11's anti-ZIKV activity directly targets viral components through post-translational modification

    • This represents a more direct antiviral mechanism that may alter viral protein function or stability

  • Potential Functional Consequences:

    • Palmitoylation of the ZIKV envelope protein may affect:

      • Viral assembly or budding processes

      • Fusion activity during viral entry

      • Interactions with host factors

      • Recognition by host immune components

This mechanism highlights the versatility of ZDHHC11 in antiviral defense, employing different strategies against DNA versus RNA viruses. The direct modification of viral proteins represents a novel host defense mechanism that could potentially be exploited for therapeutic development against flavivirus infections.

How does ZDHHC11 regulate NF-κB signaling pathways?

ZDHHC11 functions as a positive regulator of NF-κB signaling through a mechanism distinct from its role in type I interferon responses:

  • TRAF6-Dependent Mechanism:

    • ZDHHC11 physically associates with TRAF6, a key E3 ubiquitin ligase in NF-κB signaling

    • This interaction promotes TRAF6 oligomerization, which is critical for its E3 ligase activity

    • Enhanced TRAF6 oligomerization leads to increased synthesis of K63-linked ubiquitination chains

  • Downstream Signaling Effects:

    • ZDHHC11-enhanced TRAF6 activity leads to more efficient activation of TAK1

    • TAK1 activation subsequently leads to IKK complex phosphorylation

    • This results in IκB phosphorylation, ubiquitination, and degradation

    • Ultimately, NF-κB is released and translocates to the nucleus to drive target gene expression

  • Multiple Stimulus Responsiveness:

    • ZDHHC11 regulates NF-κB activation in response to diverse stimuli:

      • IL-1β signaling

      • LPS (TLR4 pathway)

      • DNA virus infection

    • This broad involvement suggests ZDHHC11 acts at a convergence point in NF-κB activation

  • In Vivo Significance:

    • Zdhhc11-/- mice exhibit lower serum IL-6 levels upon LPS/D-galactosamine treatment or HSV-1 infection

    • This phenotype aligns with ZDHHC11's role in promoting NF-κB-dependent cytokine production

    • The effect is observed across multiple inflammatory stimuli

Whether ZDHHC11 regulates TRAF6 activity through direct palmitoylation or through protein-protein interactions that facilitate optimal TRAF6 oligomerization remains to be fully elucidated. This mechanism provides insight into how ZDHHC11 contributes to both antiviral defense and inflammatory responses through distinct but interconnected pathways.

How does ZDHHC11 compare with other DHHC family members in substrate specificity?

Understanding ZDHHC11 substrate specificity relative to other DHHC family members represents an important research frontier:

  • Substrate Selection Determinants:

    • ZDHHC11 belongs to a family of 23 mammalian DHHC proteins with varying substrate preferences

    • The DHHC domain contains the catalytic Asp-His-His-Cys motif crucial for palmitoyl transfer activity

    • Regions outside the DHHC domain likely contribute to substrate recognition specificity

    • Transmembrane domains may form a lipid-binding pocket similar to that observed in ZDHHC20

  • Known Substrate Patterns:

    • ZDHHC11 appears to target proteins involved in innate immune signaling (MITA/STING pathway)

    • It also has the capacity to palmitoylate viral proteins like the Zika virus envelope protein

    • Whether ZDHHC11 has unique structural features that determine these specific interactions remains unknown

  • Methodological Approaches for Comparison:

    • Chemical genetic systems similar to those developed for ZDHHC20 could be adapted for ZDHHC11

    • Such systems enable direct mapping of protein substrates at the whole proteome level

    • By engineering ZDHHC11 to accept orthogonal lipid probes, researchers could identify direct substrates

    • Comparative analysis with other ZDHHC enzymes would reveal unique versus shared substrates

  • Structural Considerations:

    • Crystal structures from related ZDHHC family members reveal a conical transmembrane lipid-binding pocket

    • Comparative modeling of ZDHHC11 could identify unique features that contribute to its specific functions

    • Structure-guided mutational analysis could help define regions critical for substrate selection

While this research area presents technical challenges, developing a comprehensive map of ZDHHC11 substrates in comparison with other family members would significantly advance our understanding of palmitoylation biology and provide insights into the specific roles of ZDHHC11 in cellular processes.

What are the implications of ZDHHC11 circular RNA in cancer biology?

Recent research has identified a circular RNA form of ZDHHC11 (circZDHHC11) with potential implications in cancer biology, particularly in Burkitt lymphoma (BL):

  • Functional Role:

    • circZDHHC11 supports Burkitt lymphoma cell growth independent of its ability to sponge miR-150

    • This suggests alternative mechanisms by which this circular RNA promotes cancer progression

    • The function appears distinct from the linear ZDHHC11 mRNA's role in immune regulation

  • Experimental Manipulation Approaches:

    • Knockdown using shRNAs specifically targeting the back-splice junction (BSJ) region

    • Overexpression using PLC5-circ vector-based constructs containing full-length circZDHHC11

    • Deletion of miR-150 binding sites using CRISPR-based approaches to study sponging-independent functions

  • Subcellular Localization Analysis:

    • Nuclear and cytoplasmic fractionation experiments help determine circZDHHC11 distribution

    • This localization pattern may provide insights into potential mechanisms of action

    • qPCR with specific primers spanning the BSJ can quantify levels in different cellular compartments

  • Research Implications:

    • The dual functionality of ZDHHC11 (linear mRNA versus circular RNA) highlights the complex biology

    • While linear ZDHHC11 has immune regulatory functions, the circular form appears to have cancer-promoting activities

    • This presents interesting research questions regarding the regulation of linear versus circular RNA production

    • Understanding these distinct functions could inform targeted therapeutic approaches

This emerging area of research highlights how a single genetic locus can produce transcripts with distinct functions and biological impacts, adding complexity to our understanding of ZDHHC11 biology across different cellular contexts and disease states.

What are common challenges in expressing and purifying recombinant mouse ZDHHC11?

Researchers working with recombinant mouse ZDHHC11 face several technical challenges due to its transmembrane nature and enzymatic properties:

  • Protein Expression Challenges:

    • ZDHHC11 contains multiple transmembrane domains, making soluble expression difficult

    • Recommended approaches include:

      • Mammalian expression systems (HEK293T cells) for full-length protein

      • Insect cell systems (Sf9, High Five) for higher yield

      • Bacterial expression limited to soluble domains only

      • Use of fusion tags (FLAG, HA) to facilitate detection and purification

  • Solubilization and Purification Strategies:

    • Detergent selection is critical for maintaining protein structure and function

    • Gentle detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are preferred

    • Gradient purification protocols that slowly remove detergent can improve protein stability

    • Consider lipid supplementation during purification to stabilize transmembrane domains

  • Activity Preservation Solutions:

    • Include reducing agents (DTT, β-mercaptoethanol) to protect catalytic cysteine residues

    • Consider adding palmitoyl-CoA or non-hydrolyzable analogs during purification

    • Optimize buffer conditions (pH 7.2-7.4, physiological salt concentration)

    • Perform activity tests at each purification step to track functional protein recovery

  • Alternative Approaches:

    • Express truncated versions (e.g., aa1-197 and aa198-412) for domain-specific studies

    • Create point mutations (e.g., D155A&H156A, C158S) to study structure-function relationships

    • Consider cell-based assays that maintain native membrane environment

    • Use of cell-free expression systems with supplied lipids for membrane protein expression

  • Validation Methods:

    • Confirm protein identity by Western blotting with specific antibodies

    • Verify enzymatic activity using palmitoylation assays with known substrates

    • Assess protein quality through thermal stability assays

    • Evaluate oligomeric state by size exclusion chromatography

These methodological considerations are essential for obtaining functional recombinant ZDHHC11 for biochemical and structural studies.

How can researchers interpret conflicting results in ZDHHC11 functional studies?

When encountering conflicting results in ZDHHC11 research, several methodological considerations and troubleshooting approaches can help resolve discrepancies:

  • Experimental Model Variations:

    • Different cell types may express varying levels of other ZDHHC family members that compensate for ZDHHC11 deficiency

    • Mouse strain backgrounds can influence phenotypes in knockout studies

    • Primary cells versus cell lines may show different dependencies on ZDHHC11 function

    • Solution: Thoroughly characterize the experimental system, including expression of related ZDHHCs

  • Knockout/Knockdown Efficiency Considerations:

    • Incomplete knockdown may leave residual ZDHHC11 activity

    • Some phenotypes may require complete loss of function while others show gene dosage effects

    • Solution: Validate knockout/knockdown efficiency at both mRNA and protein levels

    • Compare results from different knockdown methods (siRNA, shRNA, CRISPR)

  • Substrate-Specific Effects:

    • ZDHHC11 may have multiple substrates with distinct roles in different pathways

    • Some substrates may be preferentially palmitoylated by other ZDHHCs in ZDHHC11's absence

    • Solution: Examine palmitoylation of specific substrates rather than only downstream functional outcomes

    • Consider redundancy with other ZDHHC family members for specific substrates

  • Context-Dependent Functions:

    • ZDHHC11's role may vary depending on stimulation conditions (e.g., type of viral infection)

    • Different experimental timepoints may reveal varying functions

    • Solution: Perform time-course experiments and compare across multiple stimulation conditions

    • Control for the specific pathways being activated in each experimental system

  • Technical Considerations:

    • Antibody specificity issues may affect detection of ZDHHC11 or its modification status

    • Palmitoylation is labile during sample preparation

    • Solution: Use multiple antibodies and detection methods

    • Include appropriate controls for palmitoylation assays (e.g., hydroxylamine treatment)

By systematically addressing these potential sources of discrepancy, researchers can resolve conflicting results and develop a more comprehensive understanding of ZDHHC11 function across different biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.