Recombinant Mouse Probable palmitoyltransferase ZDHHC12 (Zdhhc12)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse Zdhhc12 is synthesized using multiple expression systems:

Expression Systems

  • HEK293T cells: Produces full-length protein with C-terminal MYC/DDK tags for immunoprecipitation and Western blot applications .

  • E. coli: Generates truncated fragments (e.g., aa 67–123) for antibody validation and blocking assays .

  • Mammalian cells: Ensures proper post-translational modifications for functional studies .

Role in Cancer Biology

  • Ovarian Cancer:

    • Zdhhc12 mediates S-palmitoylation of claudin-3 (CLDN3) at Cys181/182/184, stabilizing its membrane localization and promoting tumor growth .

    • Knockdown reduces CLDN3-driven MAPK/ERK signaling and xenograft tumor growth by 50% .

  • Cisplatin Resistance:

    • Zdhhc12 overexpression correlates with mitochondrial ROS dysregulation.

    • Inhibition via siRNA or 2-bromopalmitate (2BP) enhances cisplatin cytotoxicity in ovarian cancer spheroids and xenografts .

Pathway Associations

PathwayRelated ProteinsCitation
MAPK/ERK SignalingCLDN3, ERK1/2
ROS HomeostasisMitochondrial complexes, FASN

Key Experimental Uses

  • Protein Interaction Studies: Co-immunoprecipitation assays to identify Zdhhc12-binding partners (e.g., CLDN3) .

  • Functional Knockdown: siRNA/shRNA-mediated silencing to study oncogenic roles in vitro and in vivo .

  • Drug Sensitivity Assays: Combined use with cisplatin or ROS scavengers (e.g., NAC) in 3D tumor spheroid models .

Case Study: Ovarian Cancer Organoids

  • Model: Platinum-resistant ascites-derived organoids treated with Zdhhc12 siRNA + cisplatin.

  • Outcome: 60% reduction in organoid viability vs. cisplatin-alone controls .

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of Zdhhc12 to overcome cisplatin resistance in high-grade serous ovarian cancer (HGSOC) .

  • Mechanistic Studies: Elucidate Zdhhc12’s role in non-cancer contexts (e.g., neuronal protein trafficking).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc12; Palmitoyltransferase ZDHHC12; DHHC domain-containing cysteine-rich protein 12; DHHC-12; Zinc finger DHHC domain-containing protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc12
Target Protein Sequence
MALWPPLNSGMLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLSSLLL YLAVSLMDPGYVTTQPQPQGEPKEEQAAMVPQAVPLRRCRHCLVLQPLRARHCRDCRRCV RRYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLCLAWSGLQFFQPWGLWLRSTGLL FTTFLLLSFFALVVALLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLA HFFCGWPSGPWETLSAEEEEEGSSQVV
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It exhibits palmitoyltransferase activity toward gephyrin/GPHN, regulating its clustering at synapses and its function in gamma-aminobutyric acid receptor clustering. Consequently, it indirectly regulates GABAergic synaptic transmission.
Database Links

KEGG: mmu:66220

UniGene: Mm.22538

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC12 and what is its primary function in cellular processes?

ZDHHC12 is a palmitoyl transferase enzyme belonging to the ZDHHC family of proteins characterized by their zinc finger DHHC domain. Its primary function is catalyzing protein S-palmitoylation, a reversible post-translational modification that involves the addition of palmitate groups to specific cysteine residues on target proteins. This modification plays a critical role in regulating protein localization, stability, and function within cells .

Methodology for studying ZDHHC12 function typically involves:

  • Acyl-biotin exchange (ABE) assays to detect palmitoylated proteins

  • Acyl-RAC (resin-assisted capture) techniques to purify S-palmitoylated proteins

  • Co-immunoprecipitation experiments to identify protein-protein interactions

  • Site-directed mutagenesis to create enzymatically dead variants (e.g., C127S mutation)

Research has demonstrated that ZDHHC12 significantly influences cellular signaling pathways, protein-protein interactions, and disease progression mechanisms .

How does ZDHHC12 differ from other ZDHHC family members in terms of substrate specificity?

ZDHHC12 demonstrates distinct substrate preferences compared to other ZDHHC family members. While the ZDHHC family in mammals consists of 23 members, each shows varying degrees of specificity toward different protein substrates.

Comparative substrate preferences among selected ZDHHC family members:

ZDHHC MemberConfirmed SubstratesSubcellular LocalizationTissue Enrichment
ZDHHC12CLDN3, potentially other transmembrane proteinsPlasma membrane/GolgiBroadly expressed
ZDHHC3Drp1, PI4K2α, Rac1, Gαq/11Golgi apparatusEnriched in heart, brain
ZDHHC7Rac1, various signaling moleculesGolgi apparatusMultiple tissues
ZDHHC13Drp1, Huntingtin (Htt)ER/GolgiBrain, skin
ZDHHC20YTHDF3Not specifiedUpregulated in pancreatic cancer

ZDHHC12 has been confirmed to mediate S-palmitoylation of CLDN3 (Claudin-3), which impacts its cell membrane localization and protein stability . Unlike ZDHHC13, which has been extensively studied in neurological contexts and shown to impact mitochondrial dynamics via Drp1 palmitoylation , ZDHHC12's full substrate profile remains to be fully characterized.

To determine substrate specificity experimentally:

  • Perform co-immunoprecipitation or pull-down assays between potential substrates and ZDHHC12

  • Conduct gain-of-function and loss-of-function experiments using recombinant ZDHHC12

  • Employ acyl-biotin exchange assays following ZDHHC12 manipulation to identify differentially palmitoylated proteins

What expression patterns does Zdhhc12 exhibit across different tissues and cell types?

Zdhhc12 displays variable expression patterns across tissues and cell types, with implications for its functional importance in specific biological contexts.

Based on available research data:

  • Brain tissues: Zdhhc12 shows distinct expression patterns across different brain regions. Co-expression analysis across 265 metacell types in mouse brain datasets indicates that neuronal ZDHHCs (including Zdhhc3, Zdhhc8, Zdhhc17, and Zdhhc21) form the strongest network of co-expression associations, while Zdhhc12 shows different expression patterns .

  • Cancer tissues: ZDHHC12 expression has been studied in ovarian cancer cells, where it plays a role in palmitoylating CLDN3, contributing to tumorigenesis .

For researchers interested in quantifying Zdhhc12 expression:

  • Utilize qRT-PCR with specific primers targeting Zdhhc12 mRNA

  • Perform Western blot analysis using validated ZDHHC12 antibodies (such as PACO38154)

  • Consider RNA-seq data analysis using resources like BrainPalmSeq for neuronal expression patterns

  • Employ immunohistochemistry with specific antibodies (recommended dilution IHC:1:20-1:200)

What are the optimal conditions for ensuring proper folding and activity of recombinant ZDHHC12 in experimental systems?

Obtaining functionally active recombinant ZDHHC12 requires careful consideration of expression systems and purification conditions due to its transmembrane nature and enzymatic requirements.

Recommended expression systems and conditions:

  • Mammalian cell expression (preferred):

    • HEK293T cells show successful expression of active ZDHHC12

    • Transfect cells with ZDHHC12 cDNA clone using lipid-based transfection methods

    • Optimal harvest time: 48-72 hours post-transfection

    • Include protease inhibitors during extraction to prevent degradation

  • E. coli expression (for structural studies):

    • Limited success due to transmembrane domains

    • For full-length (1-425) expression, specialized strains designed for membrane proteins are recommended

    • Consider fusion tags to improve solubility

Critical parameters for maintaining enzymatic activity:

ParameterRecommended ConditionNotes
pH7.3-7.4Critical for maintaining zinc finger structure
Storage buffer25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerolPrevents aggregation and maintains stability
Preservatives0.03% Proclin 300Alternative to sodium azide
Storage temperature-80°CAvoid repeated freeze-thaw cycles
ReconstitutionAdd 5-50% glycerol (final concentration)For long-term storage stability

For activity validation, researchers should perform ABE or acyl-RAC assays with known substrates (e.g., CLDN3) following reconstitution to confirm enzymatic activity .

How can researchers effectively distinguish between direct and indirect effects when studying ZDHHC12 knockout or overexpression models?

Distinguishing between direct effects (resulting from loss of ZDHHC12-mediated palmitoylation) and indirect effects (secondary consequences) is crucial for accurate interpretation of experimental results.

Recommended experimental approaches:

  • Use enzymatically dead controls:

    • Create and express catalytically inactive ZDHHC12 mutants (C127S or similar DHHC domain mutations)

    • Compare phenotypes between WT ZDHHC12 and inactive mutant expression to distinguish enzymatic vs. scaffolding functions

  • Employ substrate rescue experiments:

    • In ZDHHC12 knockout systems, introduce cysteine-to-serine mutations in suspected substrate proteins to mimic constitutive non-palmitoylated state

    • Alternatively, use chemical mimics of palmitoylation for rescue experiments

  • Temporal considerations:

    • Utilize inducible knockout/expression systems (e.g., tet-off systems as used for Zdhhc3 )

    • Monitor effects at multiple time points to distinguish immediate vs. delayed consequences

  • Substrate validation workflow:

    • Identify potential substrates through proteomics approaches

    • Confirm direct interaction through co-IP and proximity ligation assays (PLA)

    • Validate using in vitro palmitoylation assays with purified components

    • Mutate predicted palmitoylation sites to confirm specificity

Case study: In research on ZDHHC20-mediated palmitoylation of YTHDF3, researchers constructed two ZDHHC20 mutants (C156S and F171A) without significant catalytic activity to distinguish between enzymatic and non-enzymatic effects. This approach revealed that the catalytic activity specifically was required for the observed phenotypes in pancreatic cancer cells .

What are the most effective methods for identifying novel substrates of ZDHHC12?

Identifying novel substrates of ZDHHC12 requires a multifaceted approach combining proteomics, biochemical validation, and functional studies.

Comprehensive substrate identification protocol:

  • Large-scale proteomics screening:

    • Perform comparative acyl-biotin exchange (ABE) or acyl-RAC assays between ZDHHC12 wildtype and knockout/knockdown samples

    • Compare palmitoylomes using SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling for quantitative analysis

    • Filter candidates based on fold-change in palmitoylation status (typically >1.2-fold difference)

  • Substrate validation cascade:

    • Stage 1: Test direct binding through co-immunoprecipitation

    • Stage 2: Perform proximity ligation assays (PLA) to verify proximity in intact cells

    • Stage 3: Use recombinant proteins in pull-down assays to identify interacting regions

    • Stage 4: Map palmitoylation sites using site-directed mutagenesis of cysteine residues

    • Stage 5: Confirm using in vitro palmitoylation assays with purified components

  • Bioinformatics prediction:

    • Analyze candidate proteins for enrichment of palmitoylation motifs

    • Consider membrane proximity and subcellular localization

    • Examine evolutionary conservation of cysteine residues

Example findings from substrate identification studies:
Researchers identified CLDN3 as a ZDHHC12 substrate through screening of 23 DHHC family members. The validation process revealed that ZDHHC12 specifically interacted with CLDN3 and increased its S-palmitoylation level by 1.40-fold compared to control conditions. Knockdown of ZDHHC12 decreased CLDN3 S-palmitoylation by approximately 50% .

How do mutations in the DHHC domain of ZDHHC12 impact its enzyme kinetics and substrate recognition?

Mutations within the DHHC domain of ZDHHC12 critically affect its catalytic function and substrate interactions, with specific mutations having distinct consequences.

Key DHHC domain mutations and their effects:

  • C127S mutation:

    • Abolishes catalytic activity while maintaining protein-protein interactions

    • Used experimentally to create enzymatically dead controls

    • Results in failure to increase S-palmitoylation of substrates like CLDN3

  • Other critical residues:

    • Mutations in the DHHC tetrapeptide motif typically eliminate enzymatic activity

    • Mutations in surrounding residues may alter substrate specificity rather than completely eliminating activity

Kinetic considerations:

When analyzing ZDHHC12 enzyme kinetics, researchers should consider:

  • Initial transfer rates rather than endpoint measurements

  • Substrate concentration dependence (Km values)

  • Competition between substrates when multiple potential targets are present

  • Cofactor requirements (e.g., zinc, acyl-CoA availability)

Experimental approach for kinetic analysis:

  • Express and purify wildtype and mutant ZDHHC12 proteins

  • Perform in vitro palmitoylation assays with varying substrate concentrations

  • Measure reaction progress at multiple time points

  • Derive kinetic parameters (Km, Vmax, kcat) through appropriate modeling

Similar approaches with other ZDHHC family members have revealed mechanistic insights. For example, studies on ZDHHC20 demonstrated that mutations C156S and F171A significantly decreased catalytic palmitoylation activity, inhibiting proliferation and invasion of pancreatic cancer cells .

What role does ZDHHC12-mediated palmitoylation play in neurological function and disease pathogenesis?

ZDHHC12's role in neurological function remains less characterized compared to other ZDHHC family members, but emerging evidence suggests potential contributions to neurological processes and disease mechanisms.

Current understanding of ZDHHC12 in neurological contexts:

While ZDHHC12-specific neurological research is limited, studies on related family members provide valuable context:

  • ZDHHC13 in neurological function:

    • Zdhhc13-deficient mice show increased anxiety, hypoactivity, and decreased motor coordination

    • Loss of Zdhhc13 results in lower levels of Drp1 S-palmitoylation, affecting mitochondrial dynamics

    • These changes lead to alterations in brain bioenergetics and neurotransmitter imbalances

  • Expression patterns in neural tissues:

    • BrainPalmSeq database analysis indicates specific expression patterns of ZDHHC enzymes across brain cell types

    • Neuronal ZDHHCs (Zdhhc3, Zdhhc8, Zdhhc17, Zdhhc21) form strong co-expression networks

    • ZDHHC12 shows distinct expression patterns that may indicate specialized functions

Experimental strategies to investigate ZDHHC12 in neurological contexts:

  • Neuron-specific conditional knockout models:

    • Generate mouse models with neuron-specific deletion of Zdhhc12

    • Perform comprehensive behavioral phenotyping focused on:

      • Sensorimotor gating (prepulse inhibition test)

      • Anxiety-related behaviors (open field test)

      • Motor function (rotarod, footprint analysis)

      • Learning and memory (fear conditioning)

  • Substrate identification in neural cells:

    • Perform palmitoylome analysis in neural tissues from wildtype vs. Zdhhc12-deficient mice

    • Focus on synaptic proteins, neurotransmitter receptors, and proteins involved in neuronal development

  • Functional impact assessment:

    • Evaluate mitochondrial dynamics and bioenergetics (as done with Zdhhc13 )

    • Analyze neurotransmitter levels using HPLC

    • Assess synaptic structure and function through electrophysiology and imaging

Given the known importance of palmitoylation in neurological function and the association of dysregulated palmitoylation with neurological disorders, further investigation of ZDHHC12-specific roles represents an important research direction.

What are the optimal validation methods to confirm successful expression and activity of recombinant ZDHHC12?

Comprehensive validation of recombinant ZDHHC12 requires confirming both protein expression and enzymatic activity through multiple complementary approaches.

Expression validation methods:

  • Western blot analysis:

    • Use validated antibodies specific to ZDHHC12 (e.g., PACO38154)

    • Recommended dilution for Western blot: 1:500-1:2000

    • Include positive control samples (tissues known to express ZDHHC12)

    • Expected molecular weight: ~30.6 kDa

  • SDS-PAGE with Coomassie staining:

    • For purified recombinant protein, expect >80% purity

    • Can verify integrity and approximate molecular weight

  • Mass spectrometry:

    • For definitive identification and sequence coverage analysis

    • Useful for confirming post-translational modifications on the recombinant protein itself

Activity validation methods:

  • Acyl-biotin exchange (ABE) assay:

    • Compare palmitoylation levels of known substrate (e.g., CLDN3) with and without ZDHHC12 co-expression

    • Expected: 1.40-fold increase in substrate palmitoylation when active ZDHHC12 is present

  • Acyl-RAC (resin-assisted capture):

    • Alternative to ABE for detecting S-palmitoylated proteins

    • Useful for comparing patterns of palmitoylated proteins in cellular fractions

  • Functional readouts in cellular models:

    • For CLDN3 substrate: assess membrane localization through immunofluorescence

    • Monitor downstream signaling pathways known to be affected (e.g., MAPK/ERK pathway)

Critical controls:

  • Enzymatically dead mutant (C127S) - should express but lack activity

  • Vector-only transfection - baseline for palmitoylation levels

  • Treatment with palmitoylation inhibitor (e.g., 2-bromopalmitate) - chemical inhibition control

How should researchers approach contradictory findings when studying ZDHHC12 function across different model systems?

When confronted with contradictory findings about ZDHHC12 function across different model systems, researchers should implement a systematic troubleshooting and reconciliation approach.

Systematic reconciliation framework:

  • Examine model-specific biological contexts:

    • Genetic background considerations: Different mouse strains can show phenotypic variations despite carrying the same mutations (as observed with Zdhhc13 in C57BL/6NJ vs. FVB/N backgrounds)

    • Expression level differences: Quantify ZDHHC12 expression levels across models, as variations may explain discrepant results

    • Interacting protein availability: Map the expression of potential ZDHHC12 substrates and cofactors in each model system

  • Technical validation:

    • Antibody validation: Confirm antibody specificity through knockout controls

    • Knockout/knockdown efficiency: Verify complete vs. partial loss of function

    • Off-target effects: For siRNA/shRNA approaches, include rescue experiments with RNAi-resistant constructs

  • Temporal considerations:

    • Acute vs. chronic manipulations: Distinguish between immediate consequences and compensatory adaptations

    • Developmental timing: For developmental studies, precisely document temporal expression patterns

  • Reconciliation approaches:

    • Comparative mechanistic studies: Perform identical experiments across multiple systems

    • Substrate-focused analysis: Focus on specific ZDHHC12 substrates and their modification status

    • Cross-validation with related ZDHHC enzymes: Compare with closely related family members

Case study in reconciliation:
Research on Zdhhc13 found that mice with the same mutation showed different phenotypes depending on genetic background (C57BL/6NJ vs. FVB/N). Comprehensive behavioral testing was required to identify strain-specific differences in the manifestation of neurological phenotypes . Similar considerations may apply to ZDHHC12 studies.

What considerations are important when designing ZDHHC12 overexpression and knockout experiments?

Designing rigorous ZDHHC12 manipulation experiments requires careful consideration of expression systems, controls, and potential compensatory mechanisms.

Key experimental design considerations:

  • Expression system selection:

    SystemAdvantagesLimitationsBest Applications
    Transient transfectionRapid results, high expressionShort duration, variable expressionInitial screening, acute effects
    Stable cell linesConsistent expression, long-term studiesClonal variation, adaptationChronic effects, reproducibility
    Viral deliveryEfficient in hard-to-transfect cellsPackaging limitations, immune responsePrimary cells, in vivo delivery
    Transgenic animalsPhysiological context, tissue-specificTime-consuming, costlyIn vivo function, disease modeling
  • Critical controls:

    • Enzymatically dead mutant: Include C127S mutation as negative control for catalytic activity

    • Expression-matched controls: Ensure similar expression levels across wild-type and mutant constructs

    • Empty vector controls: Account for non-specific effects of expression system

  • Knockout/knockdown considerations:

    • Complete vs. conditional knockout: Consider embryonic lethality possibilities

    • Tissue-specific systems: Use Cre-lox or similar systems for targeted manipulation

    • Inducible systems: Consider tet-on/tet-off approaches for temporal control

    • Compensation monitoring: Assess expression changes in other ZDHHC family members

  • Rescue experiments:

    • Design RNAi-resistant constructs for knockdown rescue

    • Include both wild-type and catalytically inactive versions

    • Consider substrate-specific rescue approaches

Practical example:
For studying ZDHHC12 in a cardiac context, researchers could look to approaches used with ZDHHC3, where cardiomyocyte-specific transgenic mice were generated using a binary and inducible system consisting of the tetracycline transactivator (tTA) protein and the tet operator downstream of a modified α-myosin heavy chain (αMHC) promoter. This "tet-off" system allowed for temporal control of gene expression .

How can researchers effectively isolate and characterize the direct substrates of ZDHHC12 from complex biological samples?

Isolating and characterizing direct ZDHHC12 substrates from complex biological samples requires a multi-layered approach combining palmitoylome analysis, protein interaction studies, and functional validation.

Comprehensive substrate isolation protocol:

  • Global palmitoylome profiling:

    • Metabolic labeling: Use alkyne-palmitate analogs for click chemistry-based detection

    • ABE/acyl-RAC enrichment: Capture all S-palmitoylated proteins from tissues or cells

    • Quantitative proteomics: Compare samples with normal vs. altered ZDHHC12 expression

    • Data filtering: Identify candidates showing consistent changes (typically >1.2-fold difference)

  • Physical interaction verification:

    • Co-immunoprecipitation cascade: Test candidate substrates for physical interaction with ZDHHC12

    • Proximity ligation assay (PLA): Confirm proximity in intact cells

    • Domain mapping: Identify specific regions mediating interaction using truncation mutants

    • Direct binding: Use recombinant proteins in pull-down assays to confirm direct interaction

  • Enzymatic modification confirmation:

    • In vitro palmitoylation: Reconstitute palmitoylation reaction with purified components

    • Site mapping: Identify specific cysteine residues modified through mutagenesis

    • Palmitoylation dynamics: Assess palmitoylation turnover rates

  • Functional impact assessment:

    • Subcellular localization: Examine changes in protein distribution

    • Protein stability: Measure half-life with and without palmitoylation

    • Signaling consequences: Monitor downstream pathway activation

Practical example from CLDN3 identification:
Researchers used a systematic approach to identify ZDHHC12 as the specific palmitoyltransferase for CLDN3. This included:

  • Screening 23 mouse-derived DHHCs for interaction with FLAG-tagged CLDN3

  • Confirming increased S-palmitoylation levels with wild-type but not catalytically dead ZDHHC12

  • Verifying reduced palmitoylation upon ZDHHC12 knockdown

  • Demonstrating functional consequences through altered membrane localization and signaling pathway activation

How does ZDHHC12-mediated palmitoylation contribute to cancer progression and potential therapeutic strategies?

ZDHHC12-mediated palmitoylation has demonstrated significant roles in cancer biology, particularly in ovarian cancer, with implications for therapeutic targeting.

Established cancer-related functions:

  • Ovarian cancer progression:

    • ZDHHC12 mediates S-palmitoylation of CLDN3 (Claudin-3), a protein positively correlated with ovarian cancer tumorigenesis and progression

    • This palmitoylation promotes cell membrane localization of CLDN3 and maintains its stability

    • When ZDHHC12 is knocked down, CLDN3 becomes insufficiently S-palmitoylated, leading to intracellular distribution and increased degradation

  • Signaling pathway activation:

    • ZDHHC12-mediated CLDN3 palmitoylation affects the MAPK/ERK signaling pathway

    • Knockdown of ZDHHC12 results in diminished phosphorylation levels of ERK1/2

  • In vivo tumor growth:

    • Silencing ZDHHC12 significantly reduces tumorigenesis and tumor growth rate in xenograft models

    • The effect phenocopies CLDN3 knockdown, confirming the functional relationship

Therapeutic implications and strategies:

  • Direct ZDHHC12 inhibition:

    • Development of small molecule inhibitors targeting the DHHC domain

    • Peptide-based competitive inhibitors of ZDHHC12-substrate interactions

  • Competitive substrate approaches:

    • Researchers have designed biologically active peptides derived from substrates (similar to the YTHDF3-derived peptide approach used for ZDHHC20)

    • Such peptides competitively inhibit substrate palmitoylation

  • Combination therapy potential:

    • ZDHHC12 inhibition could sensitize cancer cells to existing chemotherapies

    • Targeting both the enzyme and downstream effectors may prevent resistance development

Clinical correlation evidence:
Studies have established a positive correlation between ZDHHC12 and CLDN3 at both protein and mRNA levels in ovarian cancer samples, supporting the clinical relevance of this mechanism .

What role might ZDHHC12 play in the context of mitochondrial dynamics and neurological disorders?

While direct evidence for ZDHHC12's role in mitochondrial dynamics and neurological disorders is limited, studies on related ZDHHC family members provide valuable insights into potential functions and research directions.

Insights from ZDHHC family research:

  • ZDHHC13 in mitochondrial function:

    • Zdhhc13-deficient mice display increased anxiety, hypoactivity, and decreased motor coordination

    • Loss of Zdhhc13 results in lower levels of Drp1 S-palmitoylation

    • This leads to altered mitochondrial dynamics, increased glycolysis, glutaminolysis, lactic acidosis, and neurotransmitter imbalances

  • ZDHHC3 in cardiac function:

    • Cardiomyocyte-specific overexpression of Zdhhc3 leads to cardiac disease

    • Rac1 was identified as a novel substrate, with enhanced S-palmitoylation leading to plasma membrane localization and activity

    • This results in downstream hypertrophic signaling and heart failure

Potential ZDHHC12 involvement in neurological contexts:

  • Expression patterns:

    • Analysis of ZDHHC expression in neural tissues shows specific patterns across brain regions

    • Co-expression networks suggest potential functional groupings of ZDHHC enzymes

  • Substrate candidates in neural function:

    • Given the importance of protein localization in neurons, ZDHHC12 may regulate trafficking of neuronal proteins

    • Synaptic proteins and neurotransmitter receptors are potential targets

Research approaches to explore ZDHHC12 in neurological disorders:

  • Expression analysis in disease models:

    • Analyze ZDHHC12 expression in tissues from patients with neurological disorders

    • Examine expression changes in animal models of neurodegeneration

  • Functional studies:

    • Generate neuron-specific Zdhhc12 knockout models

    • Perform comprehensive behavioral testing similar to that used for Zdhhc13

    • Analyze mitochondrial morphology, distribution, and function

  • Palmitoylome analysis:

    • Compare palmitoylation profiles in neural tissues with and without ZDHHC12

    • Focus on proteins involved in mitochondrial dynamics (e.g., Drp1)

This research direction represents an important opportunity to expand our understanding of palmitoylation in neurological function and potentially identify new therapeutic targets.

How can modifications to recombinant ZDHHC12 be utilized to develop enzyme inhibitors or modulators for research and therapeutic applications?

Developing effective ZDHHC12 inhibitors or modulators requires strategic approaches based on understanding enzyme structure-function relationships and leveraging recombinant protein technology.

Rational inhibitor design strategies:

  • Structure-based approaches:

    • Generate high-resolution structures of recombinant ZDHHC12 through crystallography or cryo-EM

    • Focus on the catalytic DHHC domain for competitive inhibitors

    • Target substrate binding regions for allosteric modulators

    • Analyze zinc coordination sites for metal-chelating inhibitors

  • Substrate-derived competitive inhibitors:

    • Design peptides based on known substrate sequences (similar to YTHDF3-derived peptide approach used for ZDHHC20)

    • Optimize through systematic substitutions and modifications

    • Incorporate non-hydrolyzable palmitate analogs

  • High-throughput screening platforms:

    • Develop enzymatic assays using recombinant ZDHHC12

    • Screen chemical libraries against purified enzyme

    • Validate hits in cellular systems

Recombinant ZDHHC12 modifications for research tools:

  • Engineered variants:

    • Create substrate-specific mutants through rational design

    • Develop orthogonal enzyme-substrate pairs for selective palmitoylation

    • Generate split-enzyme complementation systems for monitoring protein interactions

  • Activity-based probes:

    • Modify recombinant ZDHHC12 with chemical handles for in situ detection

    • Develop "suicide substrates" that covalently label active enzyme

  • Controlled delivery systems:

    • Encapsulate recombinant ZDHHC12 in nanoparticles for cellular delivery

    • Design cell-penetrating conjugates for intracellular enzyme replacement

Therapeutic considerations:

The development of ZDHHC12 inhibitors could have therapeutic applications in ovarian cancer, where ZDHHC12-mediated palmitoylation of CLDN3 contributes to tumorigenesis . Similar to the approach with 2-bromopalmitate (2-BP) in pancreatic cancer models , selective ZDHHC12 inhibitors might reduce tumor burden and improve survival outcomes.

Future therapeutic development should consider:

  • Selectivity among ZDHHC family members

  • Cell type-specific delivery strategies

  • Combination approaches targeting multiple nodes in palmitoylation-dependent pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.