Recombinant Mouse Probable palmitoyltransferase ZDHHC14 (Zdhhc14)

Shipped with Ice Packs
In Stock

Description

Palmitoylation Activity

ZDHHC14 catalyzes S-palmitoylation, a lipid modification critical for membrane anchoring and protein trafficking. Key substrates include:

  • PSD93: A scaffold protein clustered at the axon initial segment (AIS) in neurons. Recombinant ZDHHC14 enhances PSD93β palmitoylation by >60% compared to PSD93α in HEK293T cells .

  • Kv1 Potassium Channels: Directly binds PSD93; ZDHHC14 knockdown reduces Kv1 clustering at the AIS, increasing neuronal excitability .

In Vitro Studies

Recombinant ZDHHC14 is used to:

  • Reconstitute palmitoylation cascades in heterologous systems (e.g., HEK293T cells) .

  • Identify novel substrates via acyl-biotin exchange (ABE) assays .

Disease Relevance

  • Cancer: ZDHHC14 downregulation correlates with testicular germ cell tumors and prostate cancer. Overexpression induces caspase-dependent apoptosis .

  • Neurological Disorders: Altered Kv1 channel clustering due to ZDHHC14 dysfunction may contribute to epilepsy or hyperexcitability .

Comparative Analysis

FeatureMouse ZDHHC14 Human ZDHHC14
Amino Acid Identity100% (Native)86% (Ortholog)
TagHis tagStrep tag
Expression SystemE. coliCell-free synthesis
Key SubstratesPSD93, Kv1 channelsNot yet fully characterized

Technical Considerations

  • Reconstitution: Solubilize in deionized water (0.1–1.0 mg/mL) with 50% glycerol for stability .

  • Functional Assays: Use ABE assays or electrophysiology to validate substrate palmitoylation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc14; Palmitoyltransferase ZDHHC14; DHHC domain-containing cysteine-rich protein 14; DHHC-14; NEW1 domain-containing protein; NEW1CP; Zinc finger DHHC domain-containing protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc14
Target Protein Sequence
MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQ TGVFYLTLILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFFVMGTLLRTSFSDPGVL PRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASH CSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVIHRSQQKG FLDALKDSPASVLEAVICFFSVWSIIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYN PYSYGNIFTNCCVALCGPISPSLIDRRGYVQPDTPQPAAPSNGITMYGATQSQSDMCDQD QCIQSTKFVLQAAATPLLQSEPSLTSEELHMPGKPGLGTPCASLTLGQPTPPSSMPNLAT EATLSDIMPLKDEHGGHQFLTPDEAPSPPRMLGAGSPLAHSRTMHMLGLASQDSLHEDSV RGLVKLSSV
Uniprot No.

Target Background

Function
Palmitoyltransferase catalyzes the addition of palmitate to various protein substrates. It may exhibit palmitoyltransferase activity towards the beta-2 adrenergic receptor (ADRB2), thereby regulating G protein-coupled receptor signaling. It may also play a role in cell differentiation and apoptosis.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ZDHHC14?

ZDHHC14 is a putative protein palmitoyltransferase that catalyzes the addition of palmitate groups to substrate proteins. This post-translational modification affects protein localization, stability, and function. ZDHHC14 contains a conserved DHHC domain characteristic of palmitoyltransferases and uniquely possesses a C-terminal Type-I PDZ ligand (LSSV sequence) that enables interactions with PDZ domain-containing proteins . This enzyme facilitates the palmitoylation of specific substrates, including the scaffold protein PSD93 and Kv1-family potassium channels in neurons .

Where is ZDHHC14 predominantly expressed?

ZDHHC14 exhibits tissue-specific expression patterns with notably high expression in the hippocampus. Transcriptomic studies suggest it may be the most abundantly expressed palmitoyl acyltransferase in this brain region . Expression analysis across various tissues indicates significant presence in neuronal tissues, but the protein is also detected in testicular and prostate tissues, where its dysregulation has been linked to cancer development .

What are the known substrates of ZDHHC14?

The identified substrates of ZDHHC14 include:

  • PSD93 (both α and β isoforms) - a scaffold protein that localizes to the axon initial segment (AIS)

  • Kv1-family potassium channels (Kv1.1, Kv1.2, and Kv1.4) - voltage-gated channels critical for neuronal excitability

These substrate interactions appear to be mediated through ZDHHC14's C-terminal PDZ ligand binding to the third PDZ domain (PDZ3) of PSD93, establishing a mechanistic link between the enzyme and its neuronal substrates .

How does ZDHHC14 differ from other palmitoyl acyltransferases?

ZDHHC14 stands out among the 23-24 mammalian palmitoyl acyltransferases due to its unique C-terminal Type-I PDZ ligand (LSSV sequence). While approximately seven mouse and eight human PATs have sequences that terminate in predicted PDZ ligands, only ZDHHC14 possesses a Type-I PDZ ligand capable of binding Type-I PDZ-domain scaffold proteins . Additionally, ZDHHC14 is one of only four PATs intolerant to loss-of-function genetic mutations in humans, suggesting its functions cannot be compensated for by other PATs .

How do I design experiments to study ZDHHC14 palmitoylation activity?

To investigate ZDHHC14 palmitoylation activity, consider the following methodological approach:

  • Acyl-Biotin Exchange (ABE) Assay: This technique enables detection of protein palmitoylation by replacing thioester-linked palmitate with biotin. For ZDHHC14 studies, researchers have successfully employed this method to quantify palmitoylation changes in substrate proteins following ZDHHC14 knockdown .

  • Lentiviral-mediated shRNA Knockdown: For in vitro studies, develop lentiviral vectors expressing shRNA targeting Zdhhc14 to achieve >90% protein knockdown in neuronal cultures. Validation of knockdown efficiency should be performed by western blot analysis one week post-infection .

  • Substrate Validation: After ZDHHC14 knockdown, assess both palmitoylation status and total protein levels of potential substrates. In neurons, researchers demonstrated that Zdhhc14 knockdown reduced PSD93 palmitoylation by >60% while total PSD93 levels decreased to a lesser extent . Similar analyses should be conducted for other potential substrates.

  • Control Experiments: Include analysis of proteins not expected to be ZDHHC14 substrates (e.g., GAP43) to confirm specificity .

What experimental approaches can address the contradictory roles of ZDHHC14 in different cancer types?

The apparent contradictory roles of ZDHHC14 in cancer - tumor suppressor in testicular and prostate cancers versus promoting migration in gastric cancer - require sophisticated experimental approaches:

  • Tissue-Specific Expression Analysis: Perform comprehensive qRT-PCR and western blot analyses across diverse cancer types to establish tissue-specific expression patterns.

  • Cancer-Specific Substrate Identification: Employ proteomic approaches following ZDHHC14 manipulation (overexpression/knockdown) in different cancer cell lines to identify tissue-specific substrates.

  • Functional Assays:

    • For tumor suppressor activity: Conduct apoptosis assays (caspase activation, annexin V staining), cell viability assays, and in vivo xenograft models comparing wild-type with ZDHHC14-overexpressing cells .

    • For pro-migration activity: Implement Boyden chamber invasion assays, wound healing assays, and cell adhesion assays on fibronectin-coated surfaces .

  • Downstream Pathway Analysis: For gastric cancer migration, investigate integrin α5 and β1 expression and MMP17 expression, as these have been identified as potential downstream targets affected by ZDHHC14 expression .

How can I establish the PDZ-ligand dependency of ZDHHC14 interactions with substrates?

To confirm PDZ-ligand dependence in ZDHHC14 substrate interactions:

  • Site-Directed Mutagenesis: Generate ZDHHC14 constructs with mutated PDZ ligand sequences (e.g., changing LSSV to LSSE), which abolishes PDZ domain binding .

  • GST Pull-down Assays: Use GST-fusion proteins of wild-type (LSSV) and mutant (LSSE) ZDHHC14 C-terminal regions to pull down potential interacting proteins from cell lysates. In previous research, PSD93 isoforms bound robustly to wild-type but not mutant ZDHHC14 constructs .

  • Yeast Two-Hybrid Validation: Perform back-transformation experiments with wild-type and mutant ZDHHC14 C-termini to verify direct binding with potential substrates or interactors .

  • Co-immunoprecipitation: Conduct co-IP experiments with full-length ZDHHC14 (wild-type and PDZ ligand mutants) and candidate interacting proteins to confirm interactions in mammalian systems.

What techniques should I use to study ZDHHC14's role in neuronal excitability?

To investigate ZDHHC14's impact on neuronal excitability:

  • Patch-Clamp Electrophysiology: Perform whole-cell patch-clamp recordings in control and ZDHHC14 knockdown neurons to measure:

    • Outward potassium currents

    • Action potential frequency and threshold

    • Resting membrane potential

  • Immunofluorescence Microscopy: Visualize and quantify the localization of Kv1 channels at the axon initial segment (AIS) in control versus ZDHHC14-depleted neurons using:

    • Channel-specific antibodies

    • AIS markers (e.g., AnkyrinG)

    • Confocal or super-resolution microscopy

  • Calcium Imaging: Monitor neuronal activity patterns using calcium indicators to assess how ZDHHC14 manipulation affects network activity.

  • Rescue Experiments: Attempt to rescue phenotypes by re-expressing wild-type ZDHHC14 or catalytically inactive mutants to determine if palmitoyltransferase activity is required for its effects on neuronal excitability.

What controls are essential when studying ZDHHC14 function?

When investigating ZDHHC14 function, include the following controls:

  • Enzymatic Activity Controls:

    • Catalytically inactive ZDHHC14 mutant (mutation in the DHHC domain)

    • PDZ-ligand mutant (LSSV to LSSE) to distinguish substrate binding from catalytic activity

    • Non-substrate palmitoylated proteins (e.g., GAP43) to confirm specificity

  • Expression Controls:

    • Empty vector controls for overexpression studies

    • Non-targeting shRNA for knockdown experiments

    • Rescue experiments with shRNA-resistant ZDHHC14 constructs

  • Tissue-Specific Controls:

    • Multiple cell lines from the same tissue type to account for cell line-specific effects

    • Primary cells where feasible to validate findings from cell lines

How should I analyze ZDHHC14 expression data from different experimental conditions?

For robust analysis of ZDHHC14 expression:

  • Quantification Methods:

    • For western blots: Normalize ZDHHC14 signal to multiple housekeeping proteins

    • For qRT-PCR: Use at least 2-3 reference genes validated for stability in your experimental conditions

    • For immunofluorescence: Implement automated quantification algorithms to minimize bias

  • Statistical Approaches:

    • Perform appropriate statistical tests based on data distribution

    • Include biological replicates (n≥3) and technical replicates

    • Report effect sizes alongside p-values

  • Visualization:

    • Present individual data points alongside means/medians

    • Use consistent scaling across comparable experiments

    • Include representative images alongside quantification

What experimental challenges might I encounter when working with recombinant mouse ZDHHC14?

Researchers should anticipate several technical challenges:

  • Expression and Purification Issues:

    • ZDHHC14 is a transmembrane protein, making soluble expression challenging

    • Consider membrane-mimetic systems for functional studies

    • Use detergent screening to identify optimal solubilization conditions

  • Enzymatic Activity Assessment:

    • In vitro palmitoylation assays may require optimization of lipid composition

    • Recombinant substrates may lack necessary co-factors or accessory proteins

    • Consider cell-based assays as alternatives to purified protein systems

  • Antibody Specificity:

    • Validate antibodies using knockdown/knockout controls

    • Consider epitope tagging for detection if antibodies show cross-reactivity

How do I resolve contradictory findings regarding ZDHHC14's role in cancer progression?

The apparently contradictory roles of ZDHHC14 in different cancers require careful interpretation:

  • Context-Dependent Functions:

    • ZDHHC14 functions as a tumor suppressor in testicular germ cell tumors and prostate cancer, with overexpression increasing apoptosis

    • In gastric cancer, particularly scirrhous type, ZDHHC14 overexpression promotes migration and invasion

  • Substrate-Specific Effects:

    • In gastric cancer, ZDHHC14 appears to regulate integrin α5/β1 and MMP17, promoting invasiveness

    • In other cancers, ZDHHC14 may palmitoylate different substrates involved in apoptotic pathways

  • Experimental Approach for Reconciliation:

    • Conduct comparative proteomic analysis to identify differentially palmitoylated proteins across cancer types

    • Perform substrate validation in multiple cancer models

    • Investigate whether genomic context (mutations in other genes) influences ZDHHC14 function

What factors might affect reproducibility in ZDHHC14 functional studies?

Several factors can influence reproducibility:

  • Experimental Variables:

    • Cell passage number and culture conditions

    • Transfection or viral transduction efficiency

    • Timing of analyses post-manipulation

  • Technical Considerations:

    • Palmitoylation is labile during sample preparation

    • ABE assay conditions need careful standardization

    • Antibody lot variations can affect detection sensitivity

  • Biological Variables:

    • Endogenous expression levels of ZDHHC14 across cell lines

    • Expression of compensatory PATs

    • Substrate availability and competition

How can I analyze ZDHHC14's impact on Kv1 channel function at the axon initial segment?

To comprehensively analyze ZDHHC14's impact on Kv1 channels:

  • Quantitative Analysis Framework:

    • Measure channel clustering at the AIS using line-scan intensity profiles

    • Quantify both mean intensity and total fluorescence at the AIS

    • Assess channel distribution along the AIS (proximal vs. distal)

  • Functional Correlations:

    • Combine immunofluorescence with electrophysiology

    • Correlate Kv1 channel localization with outward current measurements

    • Assess impact on action potential waveform and firing frequency

  • Data Interpretation Guidelines:

ParameterZDHHC14 PresentZDHHC14 KnockdownInterpretation
Kv1.1 AIS LocalizationStrong signalReduced by ~40-50%ZDHHC14 required for proper AIS targeting
Kv1.2 AIS LocalizationStrong signalReduced total amountZDHHC14 affects both palmitoylation and stability
Kv1.4 AIS LocalizationStrong signalSignificantly reducedHigh dependence on ZDHHC14 for AIS localization
Outward K+ CurrentsNormalDecreasedFunctional consequence of reduced Kv1 channel localization
Action Potential FiringNormalIncreasedHyperexcitability due to reduced K+ currents

What are promising areas for future investigation of ZDHHC14 function?

Several promising research directions emerge:

  • Comprehensive Substrate Identification:

    • Employ proteomics approaches to identify the complete set of ZDHHC14 substrates across tissues

    • Develop substrate prediction algorithms based on known ZDHHC14 targets

  • Structural Biology:

    • Determine the crystal structure of ZDHHC14 in complex with substrates

    • Investigate the structural basis for PDZ domain recognition

  • In Vivo Functions:

    • Develop conditional knockout mouse models to study tissue-specific ZDHHC14 functions

    • Investigate developmental roles given its evolutionary conservation

  • Therapeutic Potential:

    • Explore ZDHHC14 as a drug target in cancers where it promotes invasion

    • Investigate whether enhancing ZDHHC14 activity could benefit cancers where it acts as a tumor suppressor

How might ZDHHC14 dysfunction contribute to neurological disorders?

Given ZDHHC14's role in neuronal excitability:

  • Potential Disease Associations:

    • Epilepsy: ZDHHC14 dysfunction could alter neuronal excitability through Kv1 channel mislocalization

    • Neurodevelopmental disorders: Disrupted axon initial segment organization could affect neural circuit formation

    • Neurodegeneration: Altered ion channel function might contribute to excitotoxicity

  • Investigative Approaches:

    • Analysis of ZDHHC14 variants in patient cohorts with neurological disorders

    • Functional characterization of disease-associated variants

    • Development of animal models with specific ZDHHC14 mutations

What technological advances would benefit ZDHHC14 research?

Several emerging technologies could advance ZDHHC14 research:

  • Live-Cell Palmitoylation Sensors:

    • Development of biosensors to track palmitoylation dynamics in real-time

    • Implementation in neuronal cultures to monitor activity-dependent palmitoylation

  • Super-Resolution Microscopy:

    • Nanoscale visualization of ZDHHC14 localization relative to substrates

    • Detailed mapping of axon initial segment protein organization

  • CRISPR-Based Approaches:

    • Creation of endogenously tagged ZDHHC14 to study physiological expression

    • Base editing to introduce specific mutations without complete gene knockout

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.