Recombinant Mouse Probable palmitoyltransferase ZDHHC16 (Zdhhc16)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanism

ZDHHC16 catalyzes protein S-palmitoylation, transferring palmitate from Palmitoyl-CoA to cysteine residues. Key mechanistic insights include:

  • Palmitoylation Cascade: ZDHHC16 palmitoylates ZDHHC6, another ER-resident palmitoyltransferase, at three cysteine residues (Cys-328, Cys-329, Cys-345) . This cascade modulates ZDHHC6’s activity, stability, and substrate specificity .

  • Regulation:

    • Depalmitoylation by APT2 dynamically controls ZDHHC6’s functional states .

    • Knockout of Zdhhc16 abolishes ZDHHC6 palmitoylation, destabilizing its interaction with substrates like calnexin and transferrin receptor .

Table 1: Experimental Insights from Studies

StudyMethodFindings
CRISPR-Cas9 KO (HAP1 cells)Acyl-RAC, siRNAZDHHC16 exclusively mediates ZDHHC6 palmitoylation; loss disrupts ER protein maturation .
Stochastic ModelingMathematical simulationZDHHC16 overexpression shifts ZDHHC6 species distribution (e.g., C<sup>011</sup> dominance), enhancing enzyme activity .
Co-expression AnalysisRNAseq datasetsZdhhc16 correlates with neuronal ZDHHCs but shows minimal co-expression with Zdhhc6 in glia .

Table 2: Substrate Specificity

SubstrateFunctionDependence on ZDHHC16
ZDHHC6ER protein palmitoylationFull
CalnexinChaperone-mediated protein foldingFull
Transferrin ReceptorIron uptakePartial

Applications in Research

  • Blocking Assays: Recombinant ZDHHC16 fragments (e.g., aa 221–265) are used as controls to validate antibodies in Western blot and immunohistochemistry .

  • Mechanistic Studies: Purified protein enables in vitro reconstitution of palmitoylation cascades .

Therapeutic Significance

  • Neurological Disorders: Dysregulation of ZDHHC16-linked palmitoylation is implicated in ER stress-related pathologies .

  • Cancer: Interaction with c-Abl suggests roles in apoptosis regulation, relevant to malignancies .

Recombinant vs. Wild-Type Comparison

FeatureRecombinant ZDHHC16Wild-Type ZDHHC16
Expression SystemE. coli (with His tag) Endogenous ER/Golgi expression
Purity>90% (SDS-PAGE verified) Tissue-dependent variability
Functional UseIn vitro assays, antibody validationIn vivo palmitoylation cascades

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Zdhhc16; Aph2; Palmitoyltransferase ZDHHC16; Abl-philin 2; Zinc finger DHHC domain-containing protein 16; DHHC-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc16
Target Protein Sequence
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA VDAAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFF YSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLK MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIETYHQTPPPTF SFRERITHKSLVYLWFLCSSVALALGALTMWHAVLISRGETSIERHINKKERRRLQAKGR VFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDPPPWVTAHSASVMA V
Uniprot No.

Target Background

Function
ZDHHC16 is a palmitoyl acyltransferase that mediates palmitoylation of proteins such as PLN and ZDHHC6. It is essential for embryonic heart development and cardiac function, likely by mediating palmitoylation of PLN, thereby affecting PLN phosphorylation and homooligomerization. ZDHHC16 is also required for eye development. It palmitoylates ZDHHC6, influencing the quaternary assembly of ZDHHC6, its localization, stability, and function. ZDHHC16 may play a role in the DNA damage response and could be involved in apoptosis regulation. Additionally, it is implicated in the proliferation of neural stem cells by regulating the FGF/ERK pathway.
Gene References Into Functions
  1. Knockout of zDHHC16, a palmitoyltransferase gene identified as an interacting protein for c-Abl, a non-receptor tyrosine kinase involved in DNA damage response, replicated most of the defects in DNA damage responses produced by the inhibition of protein palmitoylation. PMID: 27159997
  2. Aph2 is identified as a critical in vivo regulator of cardiac function, revealing roles for protein palmitoylation in the development of other organs, including eyes. PMID: 26644582
  3. Aph2 may be involved in ER stress-induced apoptosis, where c-Abl plays a significant role. PMID: 12021275
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is ZDHHC16 and what is its primary function?

ZDHHC16 (zinc finger DHHC-type palmitoyltransferase 16) is a protein-coding gene located on chromosome 10 that functions as a palmitoyl acyltransferase. It mediates S-palmitoylation, the addition of an acyl chain (typically C16 in mammals) to cysteine residues on target proteins . This post-translational modification alters protein hydrophobicity, affecting membrane interactions, protein conformation, trafficking, stability, and activity .

ZDHHC16's primary function is to palmitoylate specific protein substrates, most notably:

  • ZDHHC6, another palmitoyltransferase, establishing the first discovered palmitoylation cascade

  • Phospholamban (PLN), affecting its phosphorylation and homooligomerization

Through these and other palmitoylation activities, ZDHHC16 plays critical roles in embryonic heart development, cardiac function, eye development, DNA damage response, apoptosis regulation, and neural stem cell proliferation through FGF/ERK pathway regulation .

Where is ZDHHC16 localized in cells and what is its relationship with ZDHHC6?

ZDHHC16 localizes to the endoplasmic reticulum (ER) and Golgi apparatus under overexpression conditions . This localization is functionally significant as it positions ZDHHC16 to palmitoylate ER-localized substrates like ZDHHC6.

The relationship between ZDHHC16 and ZDHHC6 represents a unique palmitoylation cascade:

  • ZDHHC16 palmitoylates ZDHHC6 on three cysteine residues (Cys-328, Cys-329, and Cys-343) in its SH3_2 domain

  • This palmitoylation affects ZDHHC6's quaternary assembly, localization, stability, and function

  • ZDHHC6 then palmitoylates its own substrates, including calnexin, gp78, IP3 receptor, and transferrin receptor

Co-immunoprecipitation experiments confirm that these two enzymes physically interact . Interestingly, there is also genetic interaction between them, as ZDHHC6 silencing or knockout leads to increased ZDHHC16 mRNA expression , suggesting a feedback regulatory mechanism.

Unlike ZDHHC6, ZDHHC16 itself does not appear to be palmitoylated in HeLa cells, as demonstrated by both 3H-palmitate incorporation and Acyl-RAC experiments .

What are the most effective methods to detect and measure ZDHHC16 palmitoylation activity?

Several complementary approaches have proven effective for studying ZDHHC16 palmitoylation activity:

  • 3H-palmitate labeling: This radioactive metabolic labeling approach is highly sensitive for detecting palmitoylation events. It was successfully used in siRNA screens against all 23 DHHC enzymes to identify ZDHHC16 as the primary palmitoyltransferase for ZDHHC6 .

  • Acyl-RAC (Resin-Assisted Capture): This non-radioactive method isolates palmitoylated proteins and can verify ZDHHC16 targets. It was used to confirm that substrates like calnexin and transferrin receptor are no longer palmitoylated in ZDHHC6 knockout cells .

  • PEGylation analysis: This technique differentiates between palmitoylated and non-palmitoylated protein species based on molecular weight shifts. It confirmed that ZDHHC16 overexpression increases palmitoylated ZDHHC6 species and showed that ZDHHC6 palmitoylation is more pronounced in mouse tissues than in cultured cells .

  • Pulse-chase experiments: 3H-palmitate pulse-chase analysis reveals palmitate turnover dynamics. For ZDHHC6, these experiments demonstrated that 50% of palmitate is lost within approximately 1 hour, with turnover rates varying depending on which cysteine residues are available for palmitoylation .

  • CRISPR-Cas9 knockout validation: Final confirmation of ZDHHC16's role was achieved using HAP1 cells with ZDHHC16 knocked out via CRISPR-Cas9, demonstrating complete loss of ZDHHC6 palmitoylation .

MethodAdvantagesLimitationsApplications
3H-palmitate labelingHigh sensitivity, direct detectionRadioactive, requires special handlingIdentifying enzyme-substrate relationships
Acyl-RACNon-radioactive, can process multiple samplesLess sensitive than radioactive methodsVerifying palmitoylation of specific proteins
PEGylation analysisDistinguishes different palmitoylation statesMay not resolve all speciesAnalyzing palmitoylation state distribution
Pulse-chaseMeasures dynamics of palmitoylationLabor intensive, requires radioactivityDetermining palmitoylation turnover rates
CRISPR-Cas9 KODefinitive loss-of-function modelMay have compensatory effectsConfirming enzyme-substrate specificity

How do researchers accurately assess the effects of ZDHHC16 on ZDHHC6 palmitoylation states?

Evaluating the complex relationship between ZDHHC16 and ZDHHC6 requires sophisticated experimental approaches due to the multiple palmitoylation sites involved:

This multifaceted approach enabled researchers to characterize the complex dynamics of the ZDHHC16-ZDHHC6 palmitoylation cascade with unprecedented detail.

How does the ZDHHC16-ZDHHC6 palmitoylation cascade function mechanistically?

The ZDHHC16-ZDHHC6 palmitoylation cascade represents the first identified example of a palmitoylation cascade, analogous to phosphorylation cascades in signaling pathways . This system operates through the following mechanism:

This cascade provides a sophisticated mechanism for regulating palmitoylation events in the cell, with the potential for signal amplification and fine-tuning of downstream substrate modification.

What is known about the physiological substrates of ZDHHC16 and their validation methods?

Research has identified several physiological substrates of ZDHHC16, with varying levels of experimental validation:

  • ZDHHC6: The most thoroughly validated ZDHHC16 substrate, confirmed through multiple approaches:

    • siRNA screen against all 23 DHHC enzymes showing 60% reduction in ZDHHC6 palmitoylation when ZDHHC16 was silenced

    • CRISPR-Cas9 ZDHHC16 knockout in HAP1 cells demonstrating complete loss of ZDHHC6 palmitoylation

    • Overexpression of ZDHHC16 enhancing ZDHHC6 palmitoylation

    • Co-immunoprecipitation showing physical interaction between the proteins

    • Site-specific mutagenesis identifying the three palmitoylated cysteine residues

  • Phospholamban (PLN): Identified as a ZDHHC16 substrate with evidence that palmitoylation affects:

    • PLN phosphorylation

    • PLN homooligomerization

    • The association of ZDHHC16 with cardiac diseases supports the physiological relevance of this substrate

Validation methods for identifying ZDHHC16 substrates include:

MethodDescriptionExample Application
Loss-of-functionsiRNA silencing or CRISPR knockout of ZDHHC16 followed by palmitoylation assessmentDemonstrated 60% reduction in ZDHHC6 palmitoylation with ZDHHC16 siRNA
Gain-of-functionOverexpression of ZDHHC16 followed by palmitoylation assessmentEnhanced ZDHHC6 palmitoylation and increased calnexin palmitoylation
Physical interactionCo-immunoprecipitation of ZDHHC16 with potential substratesConfirmed interaction between ZDHHC16 and ZDHHC6
Site identificationMutagenesis of potential palmitoylation sitesIdentified Cys-328, Cys-329, and Cys-343 as ZDHHC16 target sites on ZDHHC6
Functional readoutAssessment of downstream effects on substrate functionShowed ZDHHC16 affects calnexin palmitoylation via ZDHHC6

The search results suggest ZDHHC16 may also play roles in DNA damage response, apoptosis regulation, and neural stem cell proliferation via the FGF/ERK pathway , implying additional substrates remain to be identified.

What are the key developmental processes regulated by ZDHHC16 and the underlying mechanisms?

ZDHHC16 plays critical roles in multiple developmental processes:

  • Embryonic heart development: ZDHHC16 is essential for proper heart development , likely through palmitoylation of phospholamban (PLN). This modification affects PLN phosphorylation and homooligomerization, which are critical regulatory mechanisms for PLN function in cardiac calcium handling and contractility . The importance of this role is underscored by the association of ZDHHC16 with various cardiac pathologies.

  • Eye development: Research indicates that ZDHHC16 is required for proper eye development . While the precise mechanisms aren't detailed in the search results, this suggests that ZDHHC16-mediated palmitoylation regulates proteins involved in ocular morphogenesis or function.

  • Neural stem cell regulation: ZDHHC16 regulates the proliferation of neural stem cells through modulation of the FGF/ERK pathway . This suggests a role in neurogenesis and potentially broader neural development processes. The FGF/ERK pathway is a key regulator of cell proliferation, differentiation, and survival during development.

The developmental significance of ZDHHC16 is further supported by the multiple disease associations related to developmental processes, particularly in the cardiovascular system. Its involvement in these diverse developmental contexts indicates that ZDHHC16-mediated palmitoylation serves as a key regulatory mechanism in embryonic development, likely affecting multiple signaling pathways and protein functions.

How is ZDHHC16 dysfunction associated with cardiac pathologies and what are the molecular mechanisms?

ZDHHC16 dysfunction is associated with numerous cardiac pathologies, with emerging understanding of the underlying molecular mechanisms:

  • Associated cardiac conditions:

    • Dilated cardiomyopathy (DCM2G, DCM1AA)

    • Hypertrophic cardiomyopathy (HCM6, HCM10)

    • Atrial standstill

    • Left ventricular noncompaction

    • Congenitally corrected transposition of the great arteries

  • Molecular mechanisms:

    a. PLN regulation: ZDHHC16 palmitoylates phospholamban (PLN), a critical regulator of cardiac contractility . This palmitoylation affects:

    • PLN phosphorylation state

    • PLN homooligomerization

    Impaired PLN palmitoylation likely disrupts calcium handling in cardiomyocytes, contributing to contractile dysfunction characteristic of cardiomyopathies.

    b. ZDHHC6 cascade disruption: Dysfunction in ZDHHC16 would disrupt the palmitoylation cascade involving ZDHHC6 , potentially affecting:

    • Calnexin function (an ER chaperone)

    • IP3 receptor function (calcium signaling)

    • Transferrin receptor function (iron metabolism)

    All of these could impact cardiac development and function.

    c. Developmental effects: ZDHHC16's role in embryonic heart development suggests that developmental defects may underlie some congenital cardiac conditions associated with ZDHHC16 dysfunction.

  • Regulatory robustness: Research on the ZDHHC16-ZDHHC6 cascade reveals that the multi-site palmitoylation system provides robustness against fluctuations in ZDHHC16 activity . This suggests that certain mutations might be tolerated while others that completely disable this buffering system could have more severe phenotypes.

The diverse cardiac phenotypes associated with ZDHHC16 dysfunction likely reflect the enzyme's multiple substrates and roles in cardiac development and function, with different mutations potentially affecting specific subsets of ZDHHC16 activities.

How does the mathematical modeling of ZDHHC16-mediated palmitoylation advance our understanding of post-translational regulatory networks?

The mathematical modeling of the ZDHHC16-ZDHHC6 palmitoylation system represents a significant advancement in understanding complex post-translational regulatory networks:

  • Multi-state modeling: The research successfully modeled a system with eight different species (based on three palmitoylation sites), demonstrating how mathematical approaches can capture complex multi-state protein modifications . This approach revealed:

    • The relative abundance of each palmitoylation state

    • The interconversion rates between states

    • The functional properties of each state

  • Integration of experimental data: The model combined:

    • Site-specific mutagenesis data

    • Experimental determination of kinetic parameters

    • Protein turnover measurements

    • Activity assessments

    This integration of diverse experimental data into a unified mathematical framework provides a template for studying other post-translational modification networks.

  • Stochastic simulations: These revealed dynamic properties not obvious from steady-state measurements, showing that:

    • Under normal conditions, ZDHHC6 molecules predominantly remain non-palmitoylated with occasional, short-lived transitions to other states

    • With ZDHHC16 overexpression, ZDHHC6 molecules rapidly cycle through all palmitoylation states

  • Flux analysis: This approach identified the primary pathways through which molecules transition between different states, revealing that C011 (palmitoylated on the second and third sites) becomes a hub of the system when ZDHHC16 activity is high .

  • Predictive power: The model successfully predicted:

    • How ZDHHC16 overexpression would affect ZDHHC6 species distribution

    • The impact of APT2 depletion on ZDHHC6 stability

    • Differences in stability between wild-type and mutant ZDHHC6

The mathematical framework developed for the ZDHHC16-ZDHHC6 system demonstrates how complex post-translational modification networks can be quantitatively understood, providing insights into regulatory principles like robustness, adaptability, and signal processing that would be difficult to discern through experimental approaches alone.

What are the emerging paradigms regarding palmitoylation cascades and their regulatory significance?

The discovery of the ZDHHC16-ZDHHC6 palmitoylation cascade has established new paradigms in understanding protein palmitoylation as a regulatory mechanism:

  • Hierarchical regulation: Similar to phosphorylation cascades, the ZDHHC16-ZDHHC6 system demonstrates that palmitoylation events can be organized hierarchically, where one palmitoyltransferase regulates another . This creates:

    • Multiple levels of control

    • Potential for signal amplification

    • Opportunities for regulatory feedback

  • Multi-site modification complexity: The presence of three palmitoylation sites on ZDHHC6 creates eight possible species with different properties:

    • Each species has unique turnover rates and activities

    • Different distribution patterns emerge under varying conditions

    • This multi-site system provides robustness to changes in ZDHHC16 activity

  • Dynamic regulation: The palmitoylation cascade is highly dynamic, with:

    • Rapid palmitate turnover (50% lost in approximately 1 hour on wild-type ZDHHC6)

    • Constant interconversion between different palmitoylation states

    • The balanced activities of ZDHHC16 (palmitoylation) and APT2 (depalmitoylation)

  • Hub formation under stimulation: Under high ZDHHC16 activity, C011 becomes a hub of the system, with most palmitoylation-depalmitoylation events occurring through this species . This suggests that certain modification states can become central nodes in regulatory networks when stimulated.

  • System robustness through multi-site modification: The presence of three palmitoylation sites, rather than just one, renders ZDHHC6 protein content robust to changes in ZDHHC16 activity . This demonstrates how multi-site modification can buffer against fluctuations in enzyme activity.

  • Tissue-specific regulation: PEGylation analysis showed that ZDHHC6 palmitoylation is more pronounced in mouse tissues than in cultured cells , suggesting tissue-specific regulation of the cascade that may relate to physiological demands.

These emerging paradigms suggest that palmitoylation cascades may be more common than previously recognized and represent sophisticated regulatory mechanisms with properties distinct from other post-translational modifications.

What are the critical knowledge gaps and future research directions in ZDHHC16 biology?

Despite significant advances in understanding ZDHHC16 function, several critical knowledge gaps remain that represent important future research directions:

  • Comprehensive substrate identification: While ZDHHC6 and PLN are confirmed substrates , the full repertoire of ZDHHC16 substrates remains unknown. Future research should employ proteome-wide approaches to identify additional targets, particularly those involved in:

    • Eye development

    • DNA damage response

    • Apoptosis regulation

    • Neural stem cell proliferation and the FGF/ERK pathway

  • Structural insights: The search results don't provide structural information about ZDHHC16. Future work should address:

    • Crystal structure determination

    • Substrate recognition mechanisms

    • Catalytic mechanism details

    • Structural basis for potential regulation of ZDHHC16 activity

  • Tissue-specific functions: While ZDHHC16 palmitoylation of ZDHHC6 appears more pronounced in mouse tissues than in cultured cells , tissue-specific functions of ZDHHC16 remain largely unexplored. Studies should investigate:

    • Tissue-specific expression patterns

    • Tissue-specific substrates

    • Differential regulation in various tissues

  • Physiological regulation: How ZDHHC16 activity is regulated under physiological and pathological conditions remains unclear. Research should explore:

    • Transcriptional regulation

    • Post-translational modifications of ZDHHC16 itself

    • Protein-protein interactions that modulate activity

    • Responses to cellular stress or developmental signals

  • Additional palmitoylation cascades: The discovery of the ZDHHC16-ZDHHC6 cascade raises the possibility that other palmitoylation cascades exist. Systematic studies of interactions between different DHHC enzymes could reveal additional hierarchical regulatory systems.

  • Therapeutic targeting: Given the association of ZDHHC16 with multiple diseases , research into therapeutic strategies targeting this enzyme or its regulatory pathways could have significant clinical implications.

Addressing these knowledge gaps will provide a more comprehensive understanding of ZDHHC16 biology and its broader implications for palmitoylation as a regulatory mechanism in health and disease.

What methodological innovations would advance research on ZDHHC16 and related palmitoyltransferases?

Advancing research on ZDHHC16 and related palmitoyltransferases will require methodological innovations in several areas:

  • Real-time palmitoylation monitoring: Development of tools to visualize palmitoylation events in living cells would revolutionize our understanding of dynamics. Potential approaches include:

    • Fluorescent palmitoylation biosensors

    • Split fluorescent protein systems that report on palmitoylation status

    • FRET-based reporters of palmitoylation state changes

  • Site-specific palmitoylation quantification: Methods to precisely measure the occupancy of specific palmitoylation sites would advance beyond current techniques that often measure total palmitoylation. Approaches might include:

    • Site-specific mass spectrometry protocols

    • Antibodies recognizing specific palmitoylated motifs

    • Chemical biology approaches with site-directed labeling

  • Integrated multi-omics approaches: Combining proteomics, transcriptomics, and metabolomics data with mathematical modeling could provide comprehensive views of how ZDHHC16 functions within broader cellular networks.

  • Advanced in vivo models: Development of sophisticated animal models would enhance physiological relevance:

    • Conditional and tissue-specific knockout models

    • Knock-in models with specific mutations found in human disease

    • Models with fluorescently tagged endogenous ZDHHC16 for localization studies

  • Structural biology techniques: Application of cutting-edge structural approaches would provide molecular insights:

    • Cryo-EM of ZDHHC16 in complex with substrates

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Computational modeling of enzyme-substrate complexes

  • Palmitoylation-focused CRISPR screens: Development of palmitoylation-specific readouts combined with genome-wide CRISPR screens could identify novel regulators of ZDHHC16 activity and palmitoylation cascades.

  • Single-cell palmitoylation analysis: Methods to assess palmitoylation states at the single-cell level would reveal cell-to-cell variability and how this contributes to cellular heterogeneity in tissues.

  • Synthetic biology approaches: Engineered palmitoylation circuits could test hypotheses about palmitoylation cascades and potentially develop applications in cell engineering.

These methodological innovations would not only advance our understanding of ZDHHC16 specifically but would also broadly impact the field of protein palmitoylation and post-translational modification research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.