Recombinant Mouse Probable palmitoyltransferase ZDHHC1 (Zdhhc1)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Mouse Probable Palmitoyltransferase ZDHHC1 (Zdhhc1) refers to a genetically engineered protein derived from the mouse ortholog of the human ZDHHC1 gene. This enzyme belongs to the DHHC family of palmitoyltransferases, which catalyze the post-translational modification of protein substrates by adding palmitate groups (S-palmitoylation). The recombinant form is typically expressed in E. coli or HEK293 cells, often with tags (e.g., His-tag) for purification and functional studies .

Key Attributes:

  • Gene: Zdhhc1 (mouse) / ZDHHC1 (human).

  • UniProt ID: Q8R0N9 (mouse) .

  • Function: S-palmitoyltransferase activity, critical for protein-lipid interactions and cellular signaling .

Protein Architecture

  • Length: Full-length protein spans 484 amino acids (aa) .

  • Domain: Contains the DHHC (Asp-His-His-Cys) catalytic motif essential for palmitoylation .

  • Transmembrane Domains: Predicted to include four transmembrane (TM) helices, anchoring it to the endoplasmic reticulum (ER) or membrane structures .

Recombinant Modifications

  • Tags: His-tag for affinity purification (e.g., nickel columns) .

  • Expression Systems: E. coli (common for cost-effective production) or HEK293 cells (for mammalian post-translational modifications) .

  • Purity: >90% as determined by SDS-PAGE .

SpecificationDetail
SpeciesMus musculus (Mouse)
SourceE. coli or HEK293 cells
TagHis-tag (N-terminal)
FormLyophilized powder or solution
Storage-20°C/-80°C (avoid freeze-thaw)

Experimental Uses

  • Immunoprecipitation (IP): Pre-coupled magnetic beads facilitate rapid target protein isolation .

  • Antibody Blocking: Control fragment for validating antibody specificity in Western blot (WB) or immunohistochemistry (IHC) .

  • Functional Studies: Investigate S-palmitoylation mechanisms (e.g., interaction with p53, SIRT2) .

Technical Advantages

  • Magnetic Beads: Uniform particle size (~2 μm) and high surface area enable efficient binding .

  • Automation Compatibility: Suitable for high-throughput screening .

Role in Disease Pathways

  • Cancer: ZDHHC1 suppresses tumor growth by inhibiting glucose metabolism and inducing apoptosis/pyroptosis. Its promoter methylation silences expression in cancers like colorectal and breast .

  • Immunotherapy: ZDHHC1-mediated autophagy modulates tumor microenvironments, enhancing immunotherapy efficacy .

  • p53 Regulation: Palmitoylates p53 at C135, C176, and C275 residues, promoting nuclear localization and tumor suppression .

Mechanistic Insights

  • Lipid Metabolism: Reduces LIPG mRNA stability via m6A modification, inhibiting colorectal cancer growth .

  • ER Stress: Induces oxidative/ER stress to trigger cell death in cancer models .

Comparative Analysis of Recombinant Forms

ProductTagHostApplication
His-tagged ZDHHC1 (Q8R0N9)HisE. coliPurification, WB, IP
Magnetic Bead-Coupled ZDHHC1NoneHEK293High-throughput IP
Full-Length ZDHHC1 (1–484 aa)His (N-term)E. coliStructural studies

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, kindly include these details in your order remarks. We will then prepare the product according to your needs.
Lead Time
The delivery time may vary depending on the purchasing method or location. For specific delivery time information, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
It is recommended to avoid repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc1; Palmitoyltransferase ZDHHC1; Zinc finger DHHC domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc1
Target Protein Sequence
MNICNKPSNKTAPEKSVWTAPSQDSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYLFFA VIGFGVLVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYSGPLPIFN RSQHAHVIEDLHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSV ASALLGVLLLVLVATYVFVEFFVNPMRLRTNQHFEVLKNHTDVWFVFLPAAPVETQAPAI LALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQHRPAQEAKETHKELESCPR KVRSIQEMEFYMRTFSHVRPEPSGQARTAALNANPSQFLATQGQVEPPLPSSSDTLALPP RIQPQKKRKRRVYRLPRSGVLDRELPLPRLRETGTPSRRSSSSSDSTSASPVHAGGSAGA YYSASAESMEEIPVAQTRLGSAALGAPGARGRESGLALQARSPAVFVSPSSGEPGTPGGG DGLP
Uniprot No.

Target Background

Function
ZDHHC1 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It exhibits palmitoyltransferase activity towards NCDN and regulates its association with endosome membranes through this palmitoylation. Additionally, ZDHHC1 possesses a palmitoyltransferase activity-independent function in DNA virus-triggered and CGAS-mediated innate immune responses. It functions as an activator of STING1 by promoting its cGAMP-induced oligomerization and the recruitment of downstream signaling components.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus.
Tissue Specificity
Expressed at high levels in fetal lung and heart. Expressed at lower levels in fetal liver and brain. Also detected in adult islet cells of pancreas, Leydig cells of testis, retina and molecular layer of cerebellum.

Q&A

What is ZDHHC1 and where is it localized in cells?

ZDHHC1, also known as Zinc Finger DHHC-Type Containing 1 (ZNF377), is a protein encoded by a gene located at chromosome 16q22.1. The protein is primarily localized on the endoplasmic reticulum (ER) and membranous structures within cells . It belongs to the family of DHHC domain-containing proteins, which are known to function as palmitoyltransferases - enzymes that catalyze the addition of palmitate to proteins, a process critical for protein trafficking and function.

What role does ZDHHC1 play in the immune response?

While ZDHHC1 itself has limited documented immune functions, the closely related ZDHHC11 has been shown to enhance MITA-mediated innate immune responses against DNA viruses by linking IRF3 to MITA. Zdhhc11-deficient mice exhibited lower cytokine levels after HSV-1 infection and were more sensitive to HSV-1-induced death . This information provides a reference point for investigating potential immune roles of ZDHHC1, particularly as ZDHHC1 expression in uterine corpus endometrial carcinoma (UCEC) has been associated with changes in immune cell populations, including CD56 bright NK cells, eosinophils, and Th2 cells .

What cellular processes are affected by ZDHHC1 expression?

ZDHHC1 influences multiple cellular processes critical for cancer development and progression:

  • Cell proliferation and apoptosis: Ectopic expression of ZDHHC1 inhibits cell proliferation and induces apoptosis .

  • Cell cycle regulation: ZDHHC1 expression results in cell cycle arrest at different phases depending on cell type (G0/G1 in HONE1 cells, G2/M in MCF7 cells) .

  • Cell migration and invasion: ZDHHC1 suppresses these processes, as demonstrated by Transwell and wound healing assays .

  • Epithelial-mesenchymal transition (EMT): ZDHHC1 promotes mesenchymal-epithelial transition (MET), upregulating epithelial markers (E-cadherin, Occludin) while downregulating mesenchymal markers (Vimentin, N-cadherin) .

  • Cancer stemness: ZDHHC1 suppresses expression of stemness markers (NANOG, SOX2, OCT4, CD44, ABCG2, BMI1) .

  • Glucose metabolism: ZDHHC1 inhibits glucose metabolism-related pathways .

How does ZDHHC1 methylation status correlate with cancer progression and patient outcomes?

The methylation status of ZDHHC1 promoter has significant implications for cancer progression and patient outcomes. In multiple carcinomas (colon, hepatocellular, nasopharyngeal, gastric, breast, and lung), tumor specimens show dramatically higher levels of ZDHHC1 promoter methylation compared to adjacent normal tissues . In uterine corpus endometrial carcinoma (UCEC), downregulated ZDHHC1 expression correlates with poor prognosis, functioning as an independent prognostic factor according to Cox regression analysis .

Researchers studying this correlation should employ:

  • Methylation-specific PCR (MSP) to detect promoter methylation

  • Bisulfite genomic sequencing (BGS) to quantify methylated CpG sites

  • Statistical analyses including Cox regression and Kaplan-Meier survival analysis

  • Nomogram construction to predict patient outcomes based on ZDHHC1 expression

What are the metabolic pathways regulated by ZDHHC1 and how do they contribute to its tumor-suppressive functions?

ZDHHC1 suppresses tumor growth partially through regulation of metabolic pathways. Proteomic analysis using 8-plex isobaric tags for relative and absolute quantitation (iTRAQ) identified altered expression of 33 proteins in ZDHHC1-expressing cells, with metabolic pathway-associated proteins exhibiting the greatest alterations . Specifically:

  • Glucose metabolism: ZDHHC1 expression leads to decreased levels of glucose transporters (GLUT1), hexokinase 2 (HXK2), and glucose-6-phosphate dehydrogenase (G6PD) .

  • Metabolite levels: Gas chromatography-mass spectrometry (GC-MS) analysis revealed decreased intracellular glucose and its metabolites (glucose-6-phosphate, pyruvic acid) in ZDHHC1-expressing cells .

  • CYGB-dependent regulation: The metabolic effects of ZDHHC1 are at least partly mediated through upregulation of cytoglobin (CYGB) .

Metabolic Pathway ComponentEffect of ZDHHC1 ExpressionMeasurement Method
GLUT1 (glucose transporter)Decreased protein levelsWestern blot
HXK2 (hexokinase 2)Decreased protein levelsWestern blot
G6PD (glucose-6-phosphate dehydrogenase)Decreased protein levelsWestern blot
Intracellular glucoseDecreased levelsGC-MS
Glucose-6-phosphateDecreased levelsGC-MS
Pyruvic acidDecreased levelsGC-MS
CYGB (cytoglobin)Increased expressionqRT-PCR, Western blot

How do oxidative stress and ER stress pathways contribute to ZDHHC1-mediated pyroptosis in cancer cells?

ZDHHC1 has been shown to induce both oxidative stress and ER stress, which ultimately lead to pyroptosis in cancer cells . The specific mechanisms involve:

  • Oxidative stress indicators:

    • Increased Reactive Oxygen Species (ROS) content

    • Elevated superoxide (O₂⁻) levels

    • Higher NADP⁺/NADPH ratio

    • Unchanged total antioxidant capacity (TAC)

  • ER stress and Unfolded Protein Response (UPR) pathway:

    • Upregulation of key factors involved in ER stress and UPR

    • Activation of NLRP3 inflammasome components

    • Increased mRNA and protein levels of NLRP3, caspase-1, IL-1β, and IL-18

  • Pyroptotic morphology:

    • Reduced membrane integrity

    • Cell swelling

    • Cell lysis

These mechanisms form a cascade where ZDHHC1 expression increases oxidative stress, which triggers ER stress, leading to activation of the NLRP3 inflammasome and subsequent pyroptosis, contributing to the tumor-suppressive effects of ZDHHC1 .

What is the relationship between ZDHHC1 and CYGB in regulating tumor cell metabolism?

The relationship between ZDHHC1 and cytoglobin (CYGB) in regulating tumor cell metabolism represents a critical mechanism underlying ZDHHC1's tumor-suppressive function:

  • Correlation: Proteomic analysis showed that CYGB expression is significantly upregulated in ZDHHC1-expressing cells, and bioinformatic analysis confirmed a positive correlation between ZDHHC1 and CYGB expression .

  • Shared metabolic effects: Both ZDHHC1 and CYGB overexpression alter glucose metabolism pathways in similar ways, as revealed by iTRAQ and GC-MS analyses .

  • Functional dependence: Knockdown of CYGB in ZDHHC1-expressing cells partially reversed:

    • ZDHHC1-induced downregulation of GLUT1 and HXK2

    • ZDHHC1-mediated inhibition of cell proliferation

    • ZDHHC1-induced apoptosis

This suggests that ZDHHC1 exerts its metabolic and tumor-suppressive effects at least partly through the CYGB-mediated glucose metabolism pathway .

What are the recommended protocols for detecting ZDHHC1 expression and methylation status?

For comprehensive analysis of ZDHHC1 expression and methylation status, researchers should employ the following methods:

  • Expression analysis:

    • Quantitative reverse-transcription PCR (qRT-PCR) to measure mRNA expression

    • Western blot to detect protein expression

    • Immunohistochemistry (IHC) for tissue samples

  • Methylation analysis:

    • Methylation-specific PCR (MSP) to detect promoter methylation

    • Bisulfite genomic sequencing (BGS) to quantify methylated CpG sites within the promoter region

    • De-methylation treatment with 5-aza-2'-deoxycytidine (Aza) alone or combined with trichostatin A (A+T) to confirm methylation-dependent silencing

  • Demethylation treatment protocol:

    • Treat cells with 5-aza-2'-deoxycytidine at 10 μM for 3 days

    • For combined treatment, add trichostatin A (100 ng/ml) for the final 24 hours

    • Extract RNA/DNA for subsequent expression and methylation analyses

What are the optimal methods for studying ZDHHC1's effects on cellular functions in vitro?

To comprehensively investigate ZDHHC1's effects on cellular functions, the following methods are recommended:

  • Cell proliferation:

    • CCK-8 assay for measuring cell viability

    • Colony formation assay for long-term growth effects

  • Cell cycle analysis:

    • Flow cytometry with propidium iodide staining

  • Apoptosis detection:

    • Annexin V-FITC/PI double staining and flow cytometry

    • Western blot for cleaved caspase-3, -7, and PARP

  • Migration and invasion:

    • Transwell assay (with or without Matrigel)

    • Wound healing assay

  • EMT assessment:

    • Immunofluorescent staining for epithelial markers (E-cadherin, Occludin) and mesenchymal markers (Vimentin, N-cadherin)

    • Western blot for these markers

  • Stemness evaluation:

    • qRT-PCR for stemness markers (NANOG, SOX2, OCT4, CD44, ABCG2, BMI1)

    • Spheroid forming assay

  • Metabolism analysis:

    • Gas chromatography-mass spectrometry (GC-MS) for metabolite profiling

    • Western blot for metabolism-related proteins (GLUT1, HXK2, G6PD)

  • Stress response measurement:

    • ROS detection kit

    • Superoxide detection kit

    • NADP⁺/NADPH ratio assay

    • Total antioxidant capacity (TAC) assay

How should researchers design in vivo experiments to validate ZDHHC1 function?

For in vivo validation of ZDHHC1 function, researchers should consider the following experimental design elements:

  • Xenograft tumor model:

    • Use nude mice (6-week-old females, BALB/c background)

    • Inject control and ZDHHC1-expressing cells subcutaneously (5×10⁶ cells per injection)

    • Monitor tumor growth by measuring tumor volume ((length × width²)/2) every 3 days

    • Harvest tumors after 3-4 weeks for weight measurement and further analyses

  • Tissue analysis:

    • Immunohistochemistry (IHC) for proliferation markers (Ki67, PCNA)

    • TUNEL staining for apoptosis detection

    • Western blot for apoptosis markers (cleaved caspase-3, -7, and PARP)

  • Genetic mouse models:

    • Generate Zdhhc1 knockout mice to study physiological functions

    • Challenge with viral infections (HSV-1) to assess immune response

    • Monitor survival rates, viral titers, and cytokine production

  • Metastasis models:

    • Tail vein injection for lung metastasis

    • Intrasplenic injection for liver metastasis

    • Bioluminescence imaging for real-time monitoring of metastasis

What techniques should be used to investigate ZDHHC1-mediated metabolic alterations?

To thoroughly investigate ZDHHC1-mediated metabolic alterations, researchers should employ a multi-omics approach:

  • Proteomics:

    • 8-plex isobaric tags for relative and absolute quantitation (iTRAQ) to identify altered proteins

    • Western blot validation of key metabolic enzymes

  • Metabolomics:

    • Gas chromatography-mass spectrometry (GC-MS) for comprehensive metabolite profiling

    • Liquid chromatography-mass spectrometry (LC-MS) for targeted metabolites

  • Data analysis:

    • Principal component analysis (PCA)

    • Partial least squares discriminant analysis (PLS-DA)

    • Orthogonal partial least squares discriminant analysis (OPLS-DA)

  • Functional metabolic assays:

    • Glucose uptake assay

    • Lactate production assay

    • Oxygen consumption rate (OCR) measurement

    • Extracellular acidification rate (ECAR) measurement

  • Rescue experiments:

    • siRNA knockdown of potential mediators (e.g., CYGB)

    • Metabolite supplementation

    • Inhibitor studies of specific metabolic pathways

How can ZDHHC1 be targeted for potential cancer therapy?

Based on the tumor-suppressive role of ZDHHC1, several therapeutic strategies could be developed:

  • Epigenetic therapy:

    • DNA methyltransferase inhibitors (e.g., 5-aza-2'-deoxycytidine) to reverse ZDHHC1 methylation

    • Histone deacetylase inhibitors as combination therapy to enhance re-expression

  • Gene therapy approaches:

    • Viral vectors for ZDHHC1 gene delivery to tumor cells

    • CRISPR-based demethylation of ZDHHC1 promoter

  • Metabolism-targeting strategies:

    • Compounds that mimic ZDHHC1's effects on glucose metabolism

    • CYGB inducers to activate the ZDHHC1-CYGB axis

  • Stress response modulation:

    • Agents that enhance ER stress or oxidative stress specifically in tumor cells

    • NLRP3 inflammasome activators to promote pyroptosis

  • Combination therapies:

    • ZDHHC1-based approaches with conventional chemotherapies

    • Integration with immunotherapy based on ZDHHC1's association with immune cell populations

What are the knowledge gaps in ZDHHC1 research that need to be addressed?

Despite significant advances, several knowledge gaps remain in ZDHHC1 research:

  • Enzymatic activity:

    • Whether ZDHHC1 functions as a palmitoyltransferase

    • Identification of specific protein substrates for ZDHHC1-mediated palmitoylation

  • Structural insights:

    • Three-dimensional structure of ZDHHC1 protein

    • Structural basis for ZDHHC1 interactions with other proteins

  • Regulatory mechanisms:

    • Transcriptional regulation of ZDHHC1 beyond methylation

    • Post-translational modifications affecting ZDHHC1 function

  • Tissue-specific roles:

    • Functions in non-cancer physiological contexts

    • Developmental roles of ZDHHC1

  • Signaling networks:

    • Comprehensive mapping of ZDHHC1-regulated pathways

    • Integration of ZDHHC1 into known cancer signaling networks

  • Clinical applications:

    • Biomarker potential in various cancer types

    • Correlation with treatment responses to existing therapies

How does ZDHHC1 interact with the immune microenvironment in tumors?

While the role of ZDHHC1 in cancer cell-intrinsic processes is being elucidated, its interaction with the tumor immune microenvironment requires further investigation:

  • Immune cell populations:

    • ZDHHC1 expression in UCEC has been associated with changes in immune cell populations, including CD56 bright NK cells, eosinophils, and Th2 cells

    • Further research is needed to determine whether these associations are causal and through what mechanisms

  • Cytokine production:

    • Whether ZDHHC1 affects cancer cell production of immunomodulatory cytokines

    • Potential impact on recruitment and activation of immune cells

  • Immunotherapy implications:

    • How ZDHHC1 status might affect responses to immune checkpoint inhibitors

    • Potential for combining ZDHHC1-targeting approaches with immunotherapy

  • Inflammatory signaling:

    • ZDHHC1 increases NLRP3, IL-1β, and IL-18 levels, which are involved in inflammatory responses

    • How this affects the broader tumor immune microenvironment remains to be determined

  • Comparative analysis with ZDHHC11:

    • ZDHHC11 enhances innate immune responses against DNA viruses

    • Whether ZDHHC1 has similar functions in viral defense and how this might relate to its tumor-suppressive role

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.