Recombinant Mouse Probable palmitoyltransferase ZDHHC20 (Zdhhc20)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Mouse Probable Palmitoyltransferase ZDHHC20 (Zdhhc20) is a cysteine-rich enzyme belonging to the DHHC protein family, which catalyzes protein S-palmitoylation—a post-translational modification critical for membrane trafficking, protein stability, and signaling. The mouse ortholog shares 89% sequence identity with human ZDHHC20, enabling cross-species functional studies . Key structural features include:

FeatureDescription
Catalytic DomainDHHC motif (Asp-His-His-Cys) in a cysteine-rich domain
Zinc Finger DomainsStructural zinc atoms critical for enzyme folding and activity
Transmembrane Topology4–6 transmembrane domains; catalytic site at membrane-cytosol interface
Substrate BindingPrefers C16 fatty acid chains but accommodates C14 and C18

Functional Insights

ZDHHC20 mediates palmitoylation of diverse substrates, influencing cellular processes:

  • Oncogenic Signaling: In pancreatic cancer, ZDHHC20 is upregulated by KRAS mutations, stabilizing MYC mRNA via YTHDF3 palmitoylation, driving tumor progression .

  • Antiviral Activity: Enhances interferon-induced transmembrane protein 3 (IFITM3) palmitoylation, restricting viral entry (e.g., SARS-CoV-2) .

  • EGFR Regulation: Palmitoylates EGFR’s cytoplasmic tail, modulating receptor internalization and degradation .

Research Applications

Recombinant mouse ZDHHC20 is widely used to study enzymatic mechanisms and substrate networks:

ApplicationKey FindingsSource
Substrate ProfilingChemical-genetic systems identified >300 substrates, including VAMP3 and BCAP31
Enzyme Activity AssaysDemonstrated preference for C16-CoA, with catalytic efficiency of 0.24 min⁻¹
Inhibitor Development2-Bromopalmitate (2-BP) inhibits ZDHHC20, reducing MYC-driven tumor growth

Disease Relevance

  • Pancreatic Cancer: ZDHHC20 overexpression correlates with poor prognosis; knockdown reduces proliferation and metastasis in vivo .

  • Viral Infections: ZDHHC20 Long isoforms are induced during SARS-CoV-2 infection, potentially exacerbating tissue damage .

  • Inflammatory Disorders: Upregulated in colitis recovery phases, suggesting roles in tissue repair .

Technical Considerations

  • Recombinant Fragments: Thermo Fisher’s control fragments (aa 81-163, aa 284-364) are used for antibody validation, requiring 100x molar excess in blocking experiments .

  • Chemical Probes: Alkynyl-fatty acid analogs (e.g., 18-Bz) enable selective labeling of ZDHHC20 substrates in live cells .

Challenges and Future Directions

  • Substrate Redundancy: Functional overlap among ZDHHC enzymes complicates target validation .

  • Therapeutic Targeting: Peptide inhibitors blocking YTHDF3 palmitoylation show promise in preclinical models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage condition, buffer components, storage temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc20; Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; DHHC domain-containing cysteine-rich protein 20; DHHC-20; Zinc finger DHHC domain-containing protein 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc20
Target Protein Sequence
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVSTISRTGEKGKTVVYLVAFHL FFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTS ASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLL YCLFVAATVLEYFIKFWTLCRRKSTENCPKNEPTVLNFPSAKFHVLFLFFVSAMFFVSVL SLFSYHCWLVGKNRTTIESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDEKKYWLVPIFSS LGDGCSFPARLVGMDPEQASVANQSDYVRSIGSNQPFPIKPLSESKNRLLDSESQWLENG AEEGVTKSGTNNHVTVEIEN
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates. It facilitates palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, influencing the duration of EGFR signaling by modulating palmitoylation-dependent EGFR internalization and degradation. This enzyme exhibits a preference for acyl-CoA with C16 fatty acid chains and can also utilize acyl-CoA with C14 and C18 fatty acid chains.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Tissue Specificity
Highest levels in lung.

Q&A

What is the primary function of ZDHHC20 in cellular physiology?

ZDHHC20 functions as a palmitoyltransferase enzyme that catalyzes S-palmitoylation, a post-translational modification involving the addition of palmitic acid to cysteine residues of target proteins. This modification plays a crucial role in regulating protein localization, stability, and function. In the context of pancreatic cancer, ZDHHC20 is abnormally overexpressed and associated with poor prognosis, as it promotes cancer progression through palmitoylation-dependent mechanisms . The enzyme is notably upregulated by KRAS signaling, which is mutated in over 90% of pancreatic intraepithelial neoplasias (PanINs) . Unlike other ZDHHC family members that show defined perinuclear localization, ZDHHC20 exhibits a unique dispersed localization pattern throughout the cell, which may contribute to its distinct substrate preferences and functional outcomes .

What are the known substrates of recombinant mouse ZDHHC20?

Recent chemical genetic approaches have identified more than 300 ZDHHC-specific substrates across various human cell lines. For ZDHHC20 specifically, key substrates include:

SubstratePalmitoylation SiteFunctional ImpactResearch Model
YTHDF3Cys474Stabilizes YTHDF3, preventing its degradation; enhances MYC expressionPancreatic cancer cells
IFITM3Multiple cysteinesEnhances antiviral activityOverexpression systems
CD151Cys11, Cys15Identified through chemical proteomicsHEK293T cells

Chemical genetic studies using engineered ZDHHC20[Y181G] mutant paired with modified probes have provided unprecedented insights into ZDHHC20's substrate network, with 213 proteins significantly enriched in HEK293T cells and 99 potential S-acylation sites identified .

How does recombinant ZDHHC20 compare structurally to wild-type mouse ZDHHC20?

Recombinant mouse ZDHHC20 should ideally maintain the critical structural features of the wild-type protein, particularly the DHHC catalytic domain. Crystal structures reveal that human ZDHHC20 forms a conical active site that accommodates specific substrates . For experimental applications, researchers should verify that recombinant ZDHHC20 retains the full catalytic activity by confirming its ability to S-palmitoylate known substrates. The catalytic cysteine (C156) is essential for palmitoyltransferase activity, as ZDHHC20[C156S] mutants were shown to be catalytically inactive in biochemical assays .

What are the optimal in vitro conditions for assessing recombinant ZDHHC20 enzymatic activity?

Based on published biochemical characterizations, optimal conditions for assessing ZDHHC20 enzymatic activity include:

ParameterRecommended ConditionRationale
Temperature37°CPhysiological temperature for mammalian enzymes
pH7.2-7.4Optimal for palmitoyltransferase activity
SubstrateYnPal-CoADemonstrated similar catalytic efficiency for WT and ZDHHC20[Y181G] with kcat/KM values of 6.8 ± 0.3 and 7.6 ± 0.3 μM respectively
Detection methodCuAAC ligation to TAMRA-azide after immunoprecipitationEnables sensitive in-gel fluorescence quantification

When designing control experiments, include catalytically inactive ZDHHC20[C156S] as a negative control, and consider the use of the palmitoyltransferase inhibitor 2-BP (2-bromopalmitate) to confirm palmitoylation-dependent effects .

How can I establish a cell-based system to study ZDHHC20-mediated protein palmitoylation?

To establish an effective cell-based system for studying ZDHHC20-mediated palmitoylation:

  • Select appropriate cell lines: PANC-1 and AsPC-1 cells have high endogenous ZDHHC20 expression and are suitable for knockdown studies, while BxPC-3 and CAPAN-1 cells with relatively low ZDHHC20 expression are ideal for overexpression studies .

  • Implement genetic manipulations: Use shRNA-mediated knockdown with at least two different gene-specific shRNAs to ensure specificity, or overexpress ZDHHC20 via transfection of expression plasmids .

  • Validate enzymatic activity: Co-express ZDHHC20 with a canonical substrate like IFITM3, followed by biochemical assays to confirm palmitoylation .

  • Apply chemical genetic approaches: For specific substrate identification, use the engineered ZDHHC20[Y181G] mutant paired with bumped probes like 18-Bz, which enables selective detection of ZDHHC20-specific palmitoylation events .

What controls should be included when working with recombinant ZDHHC20?

Proper controls are essential for rigorous ZDHHC20 research:

Control TypeImplementationPurpose
Negative enzyme controlCatalytically inactive ZDHHC20[C156S] mutantVerifies that observed effects require enzymatic activity
Negative substrate controlNon-palmitoylatable mutants (cysteine to serine)Confirms specificity of palmitoylation sites
Pharmacological control2-BP treatmentInhibits general protein palmitoylation to confirm palmitoylation dependency
Biological specificity controlKnockdown/inhibition of upstream regulators (e.g., STAT3)Validates regulatory pathways and contextual dependencies
Orthogonal validationMultiple detection methods (e.g., metabolic labeling + click chemistry, ABE assay)Ensures robust detection of palmitoylation events

How does ZDHHC20 contribute to pancreatic cancer progression?

ZDHHC20 promotes pancreatic cancer progression through multiple mechanisms:

  • Stabilization of YTHDF3: ZDHHC20 inhibits chaperone-mediated autophagic degradation of YTHDF3 through S-palmitoylation at Cys474, leading to abnormal accumulation of the oncogenic protein MYC .

  • Enhanced proliferation and invasion: Knockdown of ZDHHC20 with specific shRNAs in PANC-1 and AsPC-1 cells significantly decreases cancer cell proliferation, invasion, and migration in vitro .

  • Tumor growth promotion: In cell-derived xenograft (CDX) models, ZDHHC20 silencing inhibits tumor growth in vivo, while in the KPC mouse model, ZDHHC20 knockdown results in lower tumor weight, smaller pancreatic neoplastic lesion area, and notably, longer survival time .

  • Immune evasion: ZDHHC20 plays a critical role in promoting immune evasion by pancreatic cancer cells, particularly against natural killer (NK) cells, as demonstrated by in vivo shRNA screening experiments .

What mouse models are appropriate for studying ZDHHC20 function in cancer?

Several mouse models have been validated for studying ZDHHC20's role in cancer:

Model TypeDescriptionApplicationsKey Findings
KPC mouse modelGenetically engineered model with KRAS and p53 mutationsExamining palmitoylation effects on pancreatic cancer progressionZDHHC20 knockdown resulted in smaller neoplastic lesions and longer survival
CDX modelCell-derived xenograft modelTesting effects of ZDHHC20 manipulation on tumor growthZDHHC20 silencing inhibited tumor growth in vivo
Immunodeficient mouse modelsMice lacking functional immune systemsInvestigating immune-related functions of ZDHHC20Revealed ZDHHC20's role in immune evasion mechanisms
NK cell-depleted modelsModels with specific depletion of NK cellsExamining NK cell-specific effectsDemonstrated ZDHHC20's role in protecting tumors from NK cells

How can I target the ZDHHC20-YTHDF3-MYC axis for therapeutic development?

Targeting the ZDHHC20-YTHDF3-MYC axis offers promising therapeutic potential:

  • Peptide inhibitors: A biologically active YTHDF3-derived peptide has been designed to competitively inhibit YTHDF3 palmitoylation mediated by ZDHHC20, which downregulates MYC expression and inhibits the progression of KRAS mutant pancreatic cancer .

  • Small molecule inhibitors: While specific ZDHHC20 inhibitors are still under development, the general palmitoylation inhibitor 2-BP has been shown to counteract and even reverse the promoting effects of ZDHHC20 overexpression on cancer cell proliferation and invasion .

  • Genetic targeting: shRNA-mediated knockdown of ZDHHC20 inhibits tumor growth in vivo and could inform the development of RNA interference-based therapeutics .

  • Targeting upstream regulators: STAT3 was identified as a significant transcription factor regulating ZDHHC20, with inhibition of STAT3 significantly reducing ZDHHC20 expression, suggesting an alternative approach to modulating ZDHHC20 activity .

What are the challenges in expressing and purifying functional recombinant ZDHHC20?

Expressing and purifying functional recombinant ZDHHC20 presents several challenges:

  • Membrane protein expression: As a palmitoyltransferase, ZDHHC20 contains multiple transmembrane domains, making its expression and purification technically challenging compared to soluble proteins.

  • Maintaining enzyme activity: Preserving the catalytic function during purification is critical, as the active site contains a reactive cysteine that may be susceptible to oxidation.

  • Substrate specificity validation: Confirming that recombinant ZDHHC20 maintains its native substrate specificity is essential, particularly when using it for in vitro palmitoylation assays or substrate screening.

  • Protein stability: Evidence suggests that interactions with substrate proteins may stabilize ZDHHCs, as both ZDHHC7 and ZDHHC20 showed weaker detection when co-expressed with poorly palmitoylated IFITM3 mutants compared to wild-type IFITM3 .

How can chemical genetic approaches enhance ZDHHC20 substrate identification?

Chemical genetic approaches offer powerful tools for ZDHHC20 substrate identification:

  • Orthogonal enzyme-substrate pairs: The ZDHHC20[Y181G] mutant paired with bumped probes like 18-Bz provides selective labeling of ZDHHC20 substrates with minimal processing by wild-type ZDHHCs .

  • Proteome-wide substrate mapping: When coupled to metabolic labeling, enrichment, and quantitative proteomics, this system enabled identification of 213 proteins significantly enriched in HEK293T cells expressing ZDHHC20[Y181G] but not wild-type ZDHHC20 .

  • Cross-cellular applicability: The system has been successfully applied to multiple cell lines (HEK293T, MDA-MB-231, and PANC1), identifying both common substrates (104 proteins shared between at least two cell lines) and cell line-specific substrates .

  • Site-specific identification: The approach identified 99 potential S-acylation sites, including previously reported sites such as Cys11 and Cys15 of CD151, validating its ability to detect genuine sites of S-acylation .

What detection methods are most sensitive for measuring ZDHHC20-mediated palmitoylation?

Several complementary methods provide sensitive detection of ZDHHC20-mediated palmitoylation:

MethodDescriptionAdvantagesSensitivity
Metabolic labeling with YnPalCells metabolically incorporate alkyne-palmitate analoguesEnables live-cell labeling of newly palmitoylated proteinsHigh; can detect palmitoylation of endogenous proteins
CuAAC ligationClick chemistry reaction linking alkyne-labeled proteins to fluorophores or affinity tagsAllows visualization via in-gel fluorescence or enrichment for MSExcellent for visualizing palmitoylated proteins
Acyl-biotin exchange (ABE)Chemical conversion of palmitoylated cysteines to biotinylated cysteinesDoes not require metabolic labeling; detects all palmitoylated proteinsGood for comprehensive profiling
Engineered enzyme/probe pairsZDHHC20[Y181G] with 18-Bz probeHighly selective for ZDHHC20 substratesSuperior specificity for ZDHHC20-mediated palmitoylation
IFITM3 co-expression assayCo-expression of ZDHHC20 with IFITM3 followed by palmitoylation detectionUses a canonical substrate as reporterUseful for comparing relative activities of ZDHHC20 variants

How does ZDHHC20 contribute to immune evasion mechanisms in cancer?

ZDHHC20 has been identified as a key mediator of immune evasion in pancreatic cancer through several mechanisms:

  • Metastasis promotion: In vivo short hairpin RNA (shRNA) screening identified ZDHHC20 as a critical requirement for the spread of PDAC to distant locations without affecting cell proliferation capacity .

  • Immune system interaction: The metastasis-inhibiting effect of ZDHHC20 knockout was significantly reduced in mice lacking functional immune systems or depleted of natural killer (NK) cells, indicating ZDHHC20's role in protecting tumor cells from immune surveillance .

  • NK cell resistance: ZDHHC20 appears to promote resistance to attack by NK cells, a critical component of the innate immune system involved in eliminating cancer cells .

  • Substrate-mediated effects: Chemical genetic approaches identified several potential ZDHHC20 substrates involved in promoting metastasis and resistance to NK cell attack, though the specific mechanisms require further investigation .

What is the relationship between KRAS signaling and ZDHHC20 regulation?

KRAS signaling and ZDHHC20 regulation are intricately connected:

  • KRAS-mediated upregulation: ZDHHC20 is upregulated by KRAS, which is mutated in more than 90% of pancreatic intraepithelial neoplasias (PanINs) .

  • STAT3 as intermediary: Bioinformatic analysis identified STAT3, a transcription factor activated in KRAS-driven cancers, as having the most significant regulatory effect on ZDHHC20 expression .

  • Transcriptional control: ChIP-seq analysis revealed STAT3 binding to the promoter region of ZDHHC20, with ChIP-qPCR confirming this interaction .

  • Expression correlation: Bioinformatic analysis showed a positive correlation between ZDHHC20 and STAT3 mRNA levels in various cancers, including pancreatic cancer .

  • Functional relationship: Knockdown or inhibition of STAT3 significantly reduced ZDHHC20 expression, while STAT3 overexpression upregulated ZDHHC20 in pancreatic cancer cells, confirming their regulatory relationship .

How can ZDHHC20 research inform therapeutic strategies beyond pancreatic cancer?

ZDHHC20 research has broader implications for cancer therapeutics:

  • Targeting immune evasion mechanisms: As ZDHHC20 promotes immune evasion, inhibiting its function could enhance immune surveillance not only in pancreatic cancer but potentially in other solid tumors that evade immune detection .

  • Interferon response modulation: ZDHHC20 enhances interferon-induced antiviral activity by palmitoylating IFITM3, suggesting potential applications in modulating innate immune responses beyond cancer .

  • Combination therapy approaches: Targeting the ZDHHC20–YTHDF3–MYC axis in combination with existing therapies could enhance treatment efficacy across multiple cancer types where this pathway is dysregulated .

  • Biomarker development: ZDHHC20 overexpression predicts unfavorable prognosis in pancreatic cancer, suggesting its potential utility as a prognostic biomarker that could be investigated in other malignancies .

  • Chemical genetic platform applications: The chemical genetic system developed for ZDHHC20 substrate identification offers a versatile platform for investigating ZDHHC biology across different disease contexts, potentially catalyzing knowledge-driven selection of ZDHHCs for therapeutic validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.