Recombinant Mouse Probable palmitoyltransferase ZDHHC21 (Zdhhc21)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Probable Palmitoyltransferase ZDHHC21 (Zdhhc21)

Recombinant Mouse Probable Palmitoyltransferase ZDHHC21, referred to as Zdhhc21, is a member of the DHHC family of protein acyl transferases. These enzymes catalyze the palmitoylation of proteins, a post-translational modification that can alter protein function, localization, and stability. ZDHHC21 has been implicated in various biological processes, including inflammation, vascular function, and cancer progression.

Biological Functions of ZDHHC21

ZDHHC21 plays a crucial role in several biological pathways:

  • Inflammation and Barrier Function: In the context of severe burns, ZDHHC21 mediates gut epithelial hyperpermeability, suggesting its involvement in barrier dysfunction during inflammation .

  • Vascular Function: ZDHHC21 modulates α1 adrenergic receptor signaling by palmitoylating the α1D adrenergic receptor, affecting vascular tone and responsiveness to agonists .

  • Cancer Progression: ZDHHC21 is overexpressed in acute myeloid leukemia (AML) cells and regulates oxidative phosphorylation (OXPHOS), impacting cell differentiation and proliferation .

Role in Acute Myeloid Leukemia (AML)

In AML, ZDHHC21 is highly expressed and plays a key role in regulating OXPHOS, which is crucial for energy metabolism in cancer cells. Knockdown of ZDHHC21 reduces ATP levels and mitochondrial membrane potential, promoting myeloid differentiation . The expression of ZDHHC21 is associated with poor prognosis in AML patients.

Interaction with Mitochondrial Kinase AK2

ZDHHC21 palmitoylates the mitochondrial kinase AK2, which is involved in energy metabolism. This interaction is critical for maintaining OXPHOS activity and supporting AML cell proliferation .

Involvement in Other Cancers

While ZDHHC21 is downregulated in diffuse large B-cell lymphoma (DLBCL), its role in other cancers, such as kidney renal clear cell carcinoma (KIRC), is less clear. In KIRC, ZDHHC21 expression decreases with tumor progression .

Table 1: ZDHHC21 Expression in Different Conditions

ConditionZDHHC21 ExpressionImpact
AMLHighPromotes OXPHOS, inhibits differentiation
DLBCLLowInhibits cell proliferation
KIRCDecreases with progressionUnknown
InflammationIncreasedMediates barrier dysfunction

Figure 1: Schematic Representation of ZDHHC21's Role in AML

  • ZDHHC21 palmitoylates AK2, enhancing OXPHOS.

  • ZDHHC21 knockdown reduces ATP levels and promotes differentiation.

Figure 2: ZDHHC21 Expression in Different Tissues

  • Normal Tissue: Basal expression.

  • Cancer Tissue (e.g., AML): Overexpressed.

  • Inflamed Tissue: Upregulated.

References Ash Publications. (2023). The palmitoyltransferase ZDHHC21 regulates oxidative... Frontiers in Oncology. (2020). Bioinformatics Analysis of the Prognostic and Biological Significance... PMC. (2017). Targeting palmitoyl acyltransferase ZDHHC21 improves gut... AHA Journals. (2015). The Protein Acyl Transferase ZDHHC21 Modulates α1 Adrenergic... NCBI. (n.d.). ZDHHC21 zinc finger DHHC-type palmitoyltransferase 21 [Homo sapiens] STRING. (2024). Zdhhc21 protein (mouse) - STRING interaction network PMC. (2015). The protein acyl transferase ZDHHC21 modulates α1 adrenergic... Blood. (n.d.). Volume 142 Issue 4 Nature. (2024). Targeting ZDHHC21/FASN axis for the treatment of diffuse large B...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please include your desired format in order notes for proper preparation.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us for preferential development.
Synonyms
Zdhhc21; Gramp3; Palmitoyltransferase ZDHHC21; DHHC domain-containing cysteine-rich protein 21; DHHC21; GABA-A receptor-associated membrane protein 3; Zinc finger DHHC domain-containing protein 21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc21
Target Protein Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFC LVALVRASLTDPGRLPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIM RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR WKILWFIPFRQRQPLRVPYHFANHV
Uniprot No.

Target Background

Function
ZDHHC21, a palmitoyltransferase, catalyzes the addition of palmitate to various protein substrates. It palmitoylates sex steroid hormone receptors (ESR1, PGR, and AR), influencing their localization to the plasma membrane and regulating rapid intracellular signaling by sex hormones through ERK, AKT kinases, and cAMP generation. However, it does not affect nuclear receptor-mediated signaling. ZDHHC21 palmitoylates FYN, regulating its localization in hair follicles and playing a crucial role in epidermal homeostasis and hair follicle differentiation. By palmitoylating PLCB1 and regulating its downstream signaling, ZDHHC21 indirectly regulates endothelial barrier function and leukocyte adhesion to the endothelium. It also exhibits palmitoyltransferase activity toward ADRA1D, positively regulating its activity and expression, potentially playing a role in vascular contraction. Additionally, ZDHHC21 may palmitoylate eNOS and LCK.
Gene References Into Functions
  1. Research suggests that ZDHHC21 plays a significant role in mediating gut hyperpermeability resulting from thermal injury. PMID: 28838985
  2. ZDHHC21 F233Delta diminishes the function of vascular alpha1 adrenergic receptors, leading to reduced vascular tone, manifesting in vivo as hypotension and tachycardia. PMID: 26715683
  3. The Src-family kinase, Fyn, involved in keratinocyte differentiation, is a direct palmitoylation target of Zdhhc21 and is mislocalized in mutant follicles. PMID: 19956733
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed in Henle's layer within the hair bulb and the hair shaft cuticle (at protein level). Expression is limited to the post-mitotic lineages of inner root sheath (IRS) and cuticle.

Q&A

What is the basic function of ZDHHC21 in cellular physiology?

ZDHHC21 is a member of the DHHC family of palmitoyl acyltransferases that catalyzes protein S-palmitoylation, the covalent attachment of palmitic acid to cysteine residues. This post-translational modification increases protein hydrophobicity, affecting protein localization, stability, signaling, and protein-protein interactions. In particular, ZDHHC21 has been shown to mediate the palmitoylation of several critical substrates including FYN tyrosine kinase and amyloid precursor protein (APP) in neuronal cells, as well as PLCβ1 in endothelial cells . Palmitoylation by ZDHHC21 appears to be dynamically regulated in response to inflammatory stimuli, suggesting its involvement in pathological conditions characterized by inflammation.

How is ZDHHC21 expression regulated in different tissues?

ZDHHC21 shows variable expression patterns across different tissues. It is expressed in vascular endothelium, intestinal epithelial cells, and neuronal tissue, among others. Inflammatory cytokines such as TNF-α and IFN-γ have been shown to enhance ZDHHC21 mRNA production approximately two-fold in intestinal epithelial cells . In pathological conditions, such as kidney renal clear cell carcinoma (KIRC), ZDHHC21 expression is significantly downregulated compared to normal tissues . The tissue-specific regulation of ZDHHC21 likely contributes to its diverse roles in different physiological and pathological contexts.

What are the common experimental models used to study ZDHHC21 function?

Several experimental models have been developed to study ZDHHC21 function:

  • Genetic models: The Zdhhc21^dep/dep mouse model contains a 3-base pair deletion in the Zdhhc21 exon, resulting in loss of enzymatic function while preserving protein expression. These mice exhibit depilation and heavily pigmented greasy skin but develop normally with no obvious cardiopulmonary or microcirculatory abnormalities at baseline .

  • CRISPR/Cas9 knock-in models: ZDHHC21 T209S/T209S knock-in mice have been generated to study specific mutations, such as the T209S variant identified in familial Alzheimer's disease .

  • Cell culture systems: Primary cultures of endothelial cells, intestinal epithelial cells, and neuronal cells from wild-type and Zdhhc21^dep/dep mice are commonly used for in vitro studies of ZDHHC21 function .

  • Pharmacological approaches: 2-bromopalmitate (2-BP), an inhibitor of palmitoyl acyltransferases, is used to study the effects of ZDHHC21 inhibition in various experimental settings .

How does the ZDHHC21 p.T209S mutation contribute to Alzheimer's disease pathogenesis?

The ZDHHC21 p.T209S mutation, identified in a Han Chinese family with familial Alzheimer's disease (FAD), enhances the palmitoylation of at least two key substrates: FYN tyrosine kinase and amyloid precursor protein (APP) .

Mechanistically, increased FYN palmitoylation leads to its overactivation, which subsequently causes hyperphosphorylation of NMDAR2B. This enhanced NMDAR2B activity increases neuronal sensitivity to excitotoxicity, contributing to synaptic dysfunction and neuronal loss. Simultaneously, increased APP palmitoylation appears to enhance Aβ production, although the exact mechanism requires further investigation .

ZDHHC21 T209S/T209S knock-in mice exhibit cognitive impairment and synaptic dysfunction similar to Alzheimer's disease phenotypes. Importantly, treatment with palmitoyltransferase inhibitors reversed the synaptic function impairment in these mice, suggesting that targeting aberrant palmitoylation might represent a potential therapeutic approach for certain forms of AD .

What experimental methods are most effective for measuring ZDHHC21-mediated protein palmitoylation in neuronal systems?

Several complementary approaches are recommended for measuring ZDHHC21-mediated protein palmitoylation:

  • Resin-assisted capture (RAC): This technique allows palmitoylated proteins to be cleaved by hydroxylamine (NH₂OH) and captured with thiol-reactive Sepharose resin. This method was effectively used to demonstrate that thrombin induces increased PLCβ1 palmitoylation in wild-type endothelial cells, which was attenuated in Zdhhc21^dep/dep cells .

  • Acyl-biotin exchange (ABE) coupled with mass spectrometry: This approach enables proteome-wide identification of palmitoylated proteins. ABE combined with mass spectrometry has been successfully used to identify endothelial proteins undergoing palmitoylation upon stimulation, including PLCs and proteins related to G-protein coupled receptor signaling pathways .

  • Subcellular fractionation and immunoblotting: Since palmitoylation can affect protein localization, membrane fractionation followed by immunoblotting for proteins of interest can indirectly assess palmitoylation status .

  • Functional readouts of downstream signaling: For specific substrates, measuring downstream signaling events can serve as indirect indicators of palmitoylation status. For example, PLCβ1 signaling activation can be assessed by measuring IP3 production, intracellular calcium flux, and PKC membrane translocation .

How can researchers distinguish between the direct substrates of ZDHHC21 and secondary effects in neurodegeneration models?

Distinguishing direct ZDHHC21 substrates from secondary effects requires a multi-faceted approach:

  • In silico prediction and site-directed mutagenesis: Bioinformatic tools like CSS-palm palmitoylation algorithm can predict potential palmitoylation sites. For example, analysis of PLCβ1 identified cysteine residue 17 as a likely palmitoylation site. This prediction was verified by creating a mutant PLCβ1 (C17S) that could not be palmitoylated, which failed to augment barrier dysfunction when overexpressed in endothelial cells .

  • In vitro palmitoylation assays: Recombinant ZDHHC21 protein can be used in cell-free systems to test direct palmitoylation of candidate substrates.

  • Correlation analysis between palmitoylation and functional outcomes: Researchers should demonstrate that changes in palmitoylation status correlate with functional outcomes, and that these changes are abolished in ZDHHC21-deficient models or rescued by wild-type (but not enzymatically inactive) ZDHHC21 expression .

  • Temporal analysis: Tracking the sequence of molecular events following ZDHHC21 activation can help distinguish primary from secondary effects.

What is the role of ZDHHC21 in regulating endothelial barrier function during inflammation?

ZDHHC21 plays a critical role in mediating endothelial barrier dysfunction during inflammatory responses. When endothelial cells are exposed to inflammatory stimuli, ZDHHC21 catalyzes the palmitoylation of PLCβ1, which enhances its signaling activity . This activation leads to:

  • Increased IP3 production

  • Elevated intracellular calcium spikes

  • Enhanced PKC membrane translocation

  • Disruption of endothelial junctions

  • Increased vascular permeability

  • Enhanced leukocyte adhesion

Mice with ZDHHC21 function deficiency (Zdhhc21^dep/dep) exhibit marked resistance to inflammatory injury, characterized by reduced plasma leakage, decreased leukocyte adhesion, and ameliorated lung pathology, culminating in improved survival rates during systemic inflammatory response syndrome .

How do PLCβ1 palmitoylation and endothelial dysfunction relate in ZDHHC21-mediated inflammation?

The relationship between PLCβ1 palmitoylation and endothelial dysfunction in ZDHHC21-mediated inflammation involves several mechanistic steps:

  • Palmitoylation enhances PLCβ1 signaling activity: During inflammation, ZDHHC21 catalyzes the palmitoylation of PLCβ1 at cysteine residue 17. This modification does not significantly alter PLCβ1 membrane localization but instead enhances its signaling activity .

  • PLCβ1 activation triggers calcium signaling: Enhanced PLCβ1 activity leads to increased IP3 production and subsequent calcium release from intracellular stores. Thrombin-elicited intracellular calcium spikes are significantly diminished in Zdhhc21^dep/dep endothelial cells compared to wild-type cells .

  • Downstream activation of PKC: Following PLCβ1 activation, PKC translocates to cell membranes, a process inhibited in ZDHHC21-deficient endothelial cells .

  • Barrier dysfunction: The calcium and PKC signals ultimately lead to cytoskeletal reorganization, junction protein disassembly, and increased endothelial permeability .

Experimental evidence supporting this pathway includes:

  • PLCβ1 knockdown in wild-type endothelial cells attenuates transendothelial electrical resistance (TER) responses to thrombin

  • Overexpression of wild-type PLCβ1 in wild-type endothelial cells augments TER reduction upon thrombin stimulation

  • Overexpression of C17S mutant PLCβ1 (unable to be palmitoylated) fails to enhance barrier dysfunction

  • Overexpression of wild-type PLCβ1 in Zdhhc21^dep/dep endothelial cells fails to augment thrombin-induced barrier dysfunction

What are the optimal methods for quantifying endothelial barrier function in ZDHHC21 research?

Several complementary methods are recommended for comprehensive assessment of endothelial barrier function in ZDHHC21 research:

  • Transendothelial Electrical Resistance (TER): This technique measures the electrical resistance across an endothelial monolayer in real-time, providing sensitive detection of barrier integrity changes. TER has been effectively used to demonstrate that pharmacological inhibition of palmitoyl acyltransferases attenuates barrier leakage induced by inflammatory stimuli .

  • In vivo vascular permeability assays: Using Evans blue dye or fluorescently-labeled dextran to quantify vascular leakage in Zdhhc21^dep/dep mice compared to wild-type controls provides physiologically relevant assessment of barrier function .

  • Leukocyte adhesion assays: Quantifying leukocyte adhesion to the endothelium under flow conditions or in vivo using intravital microscopy can assess another aspect of endothelial dysfunction .

  • Immunofluorescence imaging of junction proteins: Visualizing the distribution and organization of endothelial junction proteins (VE-cadherin, ZO-1, etc.) can provide insights into the structural basis of barrier dysfunction .

How does ZDHHC21 contribute to intestinal barrier dysfunction following thermal injury?

ZDHHC21 mediates intestinal epithelial hyperpermeability following thermal injury through several mechanisms:

  • Upregulation in response to inflammatory cytokines: Intestinal epithelial cells show approximately two-fold increase in ZDHHC21 mRNA production when treated with TNF-α and IFN-γ, cytokines typically elevated after severe burns .

  • Enhanced palmitoylation of target proteins: Although the specific intestinal epithelial substrates of ZDHHC21 have not been fully characterized, the enzyme likely catalyzes palmitoylation of proteins involved in epithelial junction regulation and inflammatory signaling pathways .

  • Barrier dysfunction: The hyperpermeability response in the gut following thermal injury is significantly attenuated with pharmacological inhibition of palmitoyl acyltransferases using 2-bromopalmitate (2-BP) and in mice with genetic ablation of ZDHHC21 function .

This indicates that ZDHHC21 activation represents a critical mechanistic link between thermal injury-induced inflammation and subsequent intestinal barrier dysfunction. Targeting ZDHHC21 may therefore represent a novel therapeutic approach for preserving gut barrier function in burn patients, potentially reducing complications such as sepsis and multiple organ failure .

What experimental approaches can be used to assess intestinal epithelial permeability in ZDHHC21 research?

Several experimental approaches are effective for assessing intestinal epithelial permeability in ZDHHC21 research:

  • In vitro transepithelial electrical resistance (TEER): Measuring electrical resistance across intestinal epithelial cell monolayers (such as Caco-2 or primary intestinal epithelial cells) can quantify barrier integrity in response to experimental treatments. This technique has demonstrated that TNF-α-IFN-γ-mediated epithelial barrier dysfunction is significantly improved by pharmacological targeting of palmitoyl acyltransferases with 2-BP .

  • Paracellular permeability assays: Measuring the passage of fluorescently-labeled dextrans of various molecular weights across cell monolayers provides information about the size selectivity of barrier dysfunction.

  • In vivo intestinal permeability: Oral administration of non-absorbable markers (FITC-dextran, lactulose/mannitol) followed by measurement of their appearance in blood assesses intestinal barrier function in animal models.

  • Histological assessment: Analysis of intestinal tissue sections for morphological changes, tight junction protein localization, and inflammatory cell infiltration provides structural correlates of barrier dysfunction.

  • Ex vivo intestinal permeability: Using Ussing chambers to measure the transepithelial passage of molecules across freshly isolated intestinal segments provides a physiologically relevant assessment that preserves tissue architecture.

How is ZDHHC21 expression altered in cancer tissues, and what are the implications?

ZDHHC21 expression shows significant alterations in certain cancer types, with potential implications for tumor biology:

  • Downregulation in kidney cancer: In kidney renal clear cell carcinoma (KIRC), ZDHHC21 expression is significantly downregulated compared to normal tissues, as demonstrated in both unpaired (538 KIRC vs. 72 normal) and paired (72 KIRC vs. adjacent normal) analyses .

  • Gene alterations in KIRC: ZDHHC21 undergoes various genetic alterations in KIRC, including missense mutations. The frequency of ZDHHC21 gene alterations in KIRC varies from 0.2% to 11%, with high mRNA expression being the most common type of alteration .

  • Correlation with other ZDHHCs: ZDHHC21 expression shows high correlation with several other DHHC family members, including ZDHHC6, 17, and 20, suggesting potential functional relationships or co-regulation mechanisms in cancer .

  • miRNA regulation network: Multiple miRNAs potentially regulate ZDHHC21 expression, which may contribute to its dysregulation in cancer contexts .

The altered expression of ZDHHC21 in cancer tissues may affect the palmitoylation status of proteins involved in cancer-related processes such as cell proliferation, migration, and survival. Understanding these alterations could provide insights into novel cancer biomarkers or therapeutic targets.

What techniques are most effective for analyzing ZDHHC21 mutations and alterations in tumor samples?

Several techniques are recommended for comprehensive analysis of ZDHHC21 mutations and alterations in tumor samples:

  • Next-generation sequencing (NGS): Exome sequencing or targeted sequencing approaches can identify mutations in the ZDHHC21 gene, as demonstrated in the identification of the p.T209S mutation in a familial Alzheimer's disease pedigree . For cancer research, similar approaches can detect missense mutations and other alterations in ZDHHC21.

  • Quantitative PCR (qPCR): This technique can accurately measure ZDHHC21 mRNA expression levels in tumor versus normal tissues, as used to demonstrate upregulation of ZDHHC21 in response to inflammatory cytokines in intestinal epithelial cells .

  • Bioinformatic analysis of cancer databases: Tools like TCGA, GEPIA, and cBioPortal enable systematic analysis of ZDHHC21 alterations across large cancer cohorts. These resources can identify patterns of expression, mutation frequencies, and correlations with clinical outcomes .

  • miRNA network analysis: Platforms like GSCALite can analyze the miRNA networks potentially regulating ZDHHC21 expression in cancer contexts .

  • Protein-protein interaction (PPI) network analysis: Tools like the String database can construct interaction networks to understand how ZDHHC21 alterations might affect other proteins and pathways in cancer cells .

What are the key considerations when designing experiments with recombinant ZDHHC21 protein?

When designing experiments with recombinant mouse probable palmitoyltransferase ZDHHC21, researchers should consider:

  • Expression system selection: The choice between prokaryotic (E. coli) and eukaryotic (insect cells, mammalian cells) expression systems is critical. Since ZDHHC21 is a transmembrane protein with multiple membrane spans, eukaryotic expression systems are often preferred to ensure proper folding and post-translational modifications.

  • Purification strategy: ZDHHC21 is a membrane protein, requiring detergent-based extraction and purification methods. Careful selection of detergents that maintain enzyme activity while efficiently solubilizing the protein is essential.

  • Activity assessment: In vitro palmitoylation assays should include appropriate controls:

    • Positive controls using known ZDHHC21 substrates (e.g., FYN, PLCβ1)

    • Negative controls using enzymatically inactive ZDHHC21 mutants

    • Substrate specificity controls using proteins not known to be palmitoylated by ZDHHC21

  • Storage conditions: Optimizing buffer composition, pH, temperature, and additives to maintain ZDHHC21 stability and activity during storage is crucial.

  • Validation of functionality: Comparing the activity of recombinant ZDHHC21 with the native enzyme in cellular contexts ensures that the recombinant protein accurately reflects physiological function.

How can researchers effectively measure ZDHHC21 enzyme kinetics and substrate specificity?

Measuring ZDHHC21 enzyme kinetics and substrate specificity requires specialized approaches:

  • In vitro palmitoylation assays: These assays typically use palmitoyl-CoA as the acyl donor and purified substrate proteins. Activity can be measured using:

    • Radiolabeled [³H]-palmitoyl-CoA incorporation

    • Click chemistry with alkyne-palmitoyl-CoA followed by bioorthogonal labeling

    • Mass spectrometry to detect palmitoylated peptides

  • Kinetic parameter determination: Standard enzyme kinetics approaches can determine:

    • Km for both palmitoyl-CoA and protein substrates

    • Vmax of the palmitoylation reaction

    • Catalytic efficiency (kcat/Km)

    • Inhibition constants for various inhibitors

  • Substrate specificity analysis: Several approaches can determine ZDHHC21 substrate preferences:

    • Peptide library screening to identify consensus motifs for palmitoylation

    • Competitive assays with multiple potential substrates

    • Site-directed mutagenesis of substrate cysteine residues to confirm palmitoylation sites

  • Cellular validation: Confirming in vitro findings in cellular contexts by:

    • Overexpressing wild-type vs. enzymatically inactive ZDHHC21

    • Using ZDHHC21-deficient cells (from Zdhhc21^dep/dep mice)

    • Performing rescue experiments with wild-type vs. mutant ZDHHC21

What are the common challenges in ZDHHC21 research and how can they be addressed?

Several challenges exist in ZDHHC21 research, with potential solutions:

  • Membrane protein expression and purification:

    • Challenge: As a multi-pass membrane protein, ZDHHC21 is difficult to express and purify in active form.

    • Solution: Use specialized expression systems (mammalian, insect cells) and optimize detergent conditions for extraction while preserving activity.

  • Substrate identification:

    • Challenge: Comprehensive identification of physiological ZDHHC21 substrates remains incomplete.

    • Solution: Combine proteomics approaches (ABE-MS) with validation studies in ZDHHC21-deficient models to identify and confirm substrates .

  • Functional redundancy:

    • Challenge: The DHHC family comprises 23 members with potentially overlapping substrates and functions.

    • Solution: Use combinatorial approaches, including multiple DHHC knockdowns or inhibitors with varying specificity profiles.

  • Tissue-specific functions:

    • Challenge: ZDHHC21 appears to have tissue-specific functions that may not be apparent in global knockout models.

    • Solution: Generate tissue-specific conditional ZDHHC21 knockout mice or use tissue-specific expression systems to dissect context-dependent functions.

  • Translating findings to human disease:

    • Challenge: Bridging the gap between mouse models and human pathology.

    • Solution: Validate findings in human samples and patient-derived cells, and look for ZDHHC21 variants in human genomic databases to identify potential disease associations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.