Recombinant Mouse Probable palmitoyltransferase ZDHHC24 (Zdhhc24)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purity

Recombinant Mouse Zdhhc24 is produced via cell-free expression systems or mammalian cell lines (e.g., CHO DG44) to ensure proper folding and post-translational modifications . Key production metrics include:

  • Purity: ≥85% as verified by SDS-PAGE .

  • Host Systems: E. coli, yeast, baculovirus, or mammalian cells .

  • Applications: Substrate identification, enzymatic activity assays, and structural studies .

The IR/MAR plasmid amplification method enhances yield in mammalian systems, achieving stable, high-density production without gene silencing .

Substrate Identification and Mechanistic Insights

Zdhhc24’s substrates include small GTPases (e.g., Rac1) and signaling proteins. A chemical-genetic profiling system identified >300 putative ZDHHC-specific substrates, revealing Zdhhc24’s role in:

  • Cardiac Hypertrophy: Overexpression in mice increases Rac1 palmitoylation, activating hypertrophic signaling pathways .

  • Neuronal Function: Co-expressed with Zdhhc3/7/17 in mouse brain metacells, suggesting roles in neurotransmission or synaptic plasticity .

  • Cancer: Modulates oncogenic pathways via palmitoylation of membrane receptors (e.g., EGFR) .

Disease Relevance and Therapeutic Potential

  • Cardiomyopathy: Transgenic mice overexpressing Zdhhc3 (a homolog) develop heart failure via Rac1 hyperactivation, implicating Zdhhc24 in similar pathways .

  • Cancer: Altered ZDHHC24 expression correlates with tumor progression in glioblastoma and breast cancer .

  • Neurological Disorders: Brain-specific co-expression patterns suggest links to neurodevelopmental or degenerative diseases .

Comparative Analysis Across Species

Zdhhc24 is evolutionarily conserved, with orthologs in humans (ZDHHC24), rats, and even gray mouse lemurs (Microcebus murinus) . Functional studies in these models highlight conserved roles in lipid metabolism and cellular signaling.

SpeciesGene IDProtein IdentityNotable Studies
Mouse (M. musculus)Zdhhc24100%Cardiac hypertrophy models
Human (H. sapiens)ZDHHC2485%Cancer biomarker analyses
Gray Mouse Lemur10586748882%Evolutionary conservation studies

Research Tools and Reagents

  • Antibodies: Thermo Fisher’s PA5-53461 (anti-ZDHHC24) validated for WB, IHC, and ICC .

  • Control Proteins: Recombinant fragments (aa 217–284) for antibody blocking .

  • ORF Clones: Available for Microcebus murinus and other species .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc24; Probable palmitoyltransferase ZDHHC24; Zinc finger DHHC domain-containing protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc24
Target Protein Sequence
MGESWAARGAEGAPARMPLVLTALWAAVVVLELAYVMVLGPGPPPLGPLARALQLALAAY QLLNLLGNVVLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR DHHCRLLGCCVGFHNYRPFLCLLLHSAGVLLHISVLLGPALSALLQAHSALYTVALLLLP WLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGHHCYDLG TCHNLQAALGPRWALVWFWPFLASPLPGDGISFQTPGDVGLVTS
Uniprot No.

Target Background

Function
Probable palmitoyltransferase that potentially catalyzes the addition of palmitate to various protein substrates.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse ZDHHC24 and what cellular functions does it perform?

Mouse ZDHHC24 is a member of the zinc finger DHHC-type containing (ZDHHC) family of S-acyltransferases, which are integral membrane enzymes that catalyze the addition of long-chain fatty acids (typically palmitate) to cysteine residues in substrate proteins. ZDHHC24 is predicted to enable protein-cysteine S-palmitoyltransferase activity and is involved in protein targeting to membranes. It is predicted to be active in the Golgi apparatus and endoplasmic reticulum, consistent with the localization of many ZDHHC family members . Like other ZDHHC enzymes, it likely plays a role in regulating protein localization, stability, and function through S-acylation, which affects approximately 12% of the human proteome .

How does the structure of ZDHHC24 compare to other ZDHHC family members?

ZDHHC24 contains the characteristic Palmitoyltransferase DHHC domain (IPR001594) that defines this enzyme family . This domain features the conserved Asp-His-His-Cys (DHHC) motif that is critical for catalytic function. The DHHC domain is embedded within a structure formed by transmembrane helices that create a fatty acyl-binding cavity, as observed in the high-resolution structure of human ZDHHC20 . While specific structural details of ZDHHC24 are not directly provided in the available data, it likely shares the common structural features of the ZDHHC family, including multiple transmembrane domains and cytoplasmic loops containing the catalytic DHHC motif. The protein length for mouse ZDHHC24 is reported as 295 amino acids .

What is the catalytic mechanism of ZDHHC enzymes like ZDHHC24?

The ZDHHC catalytic cycle occurs in two principal stages:

  • Auto-S-acylation: The conserved cysteine in the DHHC motif undergoes auto-S-acylation by reacting with acyl-CoA (commonly palmitoyl-CoA), resulting in the release of CoA-SH.

  • S-acyl transfer: The acyl group is subsequently transferred from the enzyme to a cysteine residue on a substrate protein that is positioned proximal to the ZDHHC catalytic site .

This two-step mechanism is essential for the function of all ZDHHC family members, including ZDHHC24. Importantly, substrate proteins do not contain a strict consensus sequence beyond requiring a free cysteine, suggesting that substrate specificity is largely determined by protein-protein interactions and colocalization rather than specific sequence recognition .

What expression systems are most effective for producing recombinant mouse ZDHHC24?

For membrane proteins like ZDHHC24, mammalian expression systems such as HEK293 cells are typically preferred to ensure proper folding and post-translational modifications. Based on methodologies used for other ZDHHC family members, transfection of HEK293 cells with vectors containing HA-tagged ZDHHC24 has been successfully employed . For high-throughput screening applications or when studying enzyme-substrate interactions, cellular expression systems that maintain the native membrane environment are crucial for preserving enzymatic activity. When expressing recombinant ZDHHC24, it's important to consider that overexpression might lead to mislocalization or altered activity, so expression levels should be carefully optimized.

What are the critical considerations for purifying functional ZDHHC24?

Purification of functional ZDHHC24 presents several challenges due to its integral membrane nature. Key considerations include:

  • Detergent selection: Dodecylphosphocholine (DPC) has been effectively used for extracting membrane proteins like ZDHHCs while maintaining their functional integrity .

  • Protection of thioester linkages: To prevent deacylation of auto-palmitoylated enzyme during purification, samples should be processed rapidly (within approximately 2 days) with minimal refreezing cycles .

  • Buffer composition: Buffers should be optimized to maintain enzyme stability while preventing aggregation of hydrophobic transmembrane regions.

  • Maintaining reducing conditions: This helps prevent unwanted disulfide formation involving catalytic and regulatory cysteines.

For activity assays using purified enzyme, it's crucial to verify that the purification method preserves the native conformation and catalytic activity of ZDHHC24.

How can I verify the activity of recombinant ZDHHC24 after purification?

A facile assay for verifying ZDHHC activity involves testing the auto-S-palmitoylation capability of the purified enzyme. This can be accomplished by:

  • Incubating the recombinant ZDHHC24 with fluorescent palmitoyl-CoA analogs such as NBD-palmitoyl-CoA.

  • Separating the reaction products by SDS-PAGE.

  • Detecting NBD fluorescence using a fluorescence scanner or imaging system.

  • Normalizing fluorescence signals to protein expression levels determined by Western blotting .

This approach allows rapid assessment of enzyme functionality by measuring its ability to undergo auto-S-palmitoylation, which is the necessary first step in the catalytic cycle. For ZDHHC24 specifically, optimized conditions might include using higher concentrations of NBD-palmitoyl-CoA (25 μM) and additional purification steps to reduce background noise, as has been necessary for detection of some ZDHHCs with weaker signals .

What methods are available to identify ZDHHC24-specific substrates?

Identifying specific substrates of individual ZDHHC enzymes like ZDHHC24 has been challenging due to the functional redundancy among family members. Recent advanced approaches include:

  • Chemical-genetic systems: Engineering paired ZDHHC "hole" mutants and "bumped" chemically tagged fatty acid probes enables selective labeling of specific protein substrates. This approach has been successfully implemented for five human ZDHHCs (3, 7, 11, 15, and 20) and could potentially be adapted for ZDHHC24 .

  • Orthogonal enzyme-substrate design: This strategy involves creating synthetic fatty acyl-CoA analogs that are selectively utilized by engineered variants of ZDHHCs but not by wild-type enzymes. This approach has successfully identified both known and novel substrates for ZDHHCs 3 and 20 .

  • Comparative proteomics: Comparing the palmitoylated proteome in cells with ZDHHC24 overexpression, knockdown, or knockout can help identify potential substrates, though this approach may be confounded by compensatory effects from other ZDHHCs.

When designing substrate identification experiments, it's essential to include appropriate controls, such as catalytically inactive ZDHHC24 mutants (e.g., with the active site cysteine mutated to serine).

How can I differentiate between direct and indirect ZDHHC24 substrates?

Distinguishing direct ZDHHC24 substrates from proteins indirectly affected by ZDHHC24 activity requires multiple complementary approaches:

  • In vitro palmitoylation assays: Using purified ZDHHC24 and candidate substrate proteins can demonstrate direct enzymatic activity.

  • Structure-guided mutagenesis: Mutations in the ZDHHC24 active site or substrate binding regions that specifically disrupt interactions with certain substrates can help validate direct enzyme-substrate relationships.

  • Proximity-based labeling: Techniques like BioID or APEX2 fused to ZDHHC24 can identify proteins in close proximity, potentially representing direct substrates.

  • Time-course experiments: Direct substrates typically show more rapid palmitoylation kinetics following ZDHHC24 activation compared to indirect effects.

A comprehensive workflow might involve initial identification of candidate substrates through proteome-wide approaches, followed by validation using more targeted techniques to confirm direct ZDHHC24-substrate interactions.

What experimental controls are essential when studying ZDHHC24 activity?

When investigating ZDHHC24 activity, several critical controls should be included:

  • Catalytically inactive mutants: ZDHHC24 with a cysteine-to-serine mutation in the DHHC motif should be used as a negative control. This mutation abolishes auto-S-palmitoylation capability while maintaining protein structure .

  • Wild-type ZDHHC24: Essential for comparative analysis with mutants and for establishing baseline activity levels.

  • Other ZDHHC family members: Including related ZDHHCs helps determine substrate specificity and functional redundancy.

  • Hydroxylamine treatment: This chemical cleaves thioester bonds and can verify that observed modifications are indeed S-acylation.

  • Background acyl-CoA depletion: In membrane-based assays, depleting endogenous acyl-CoA improves signal-to-noise ratio and ensures that observed activity is due to the added acyl-CoA substrate .

  • Expression level normalization: When comparing different ZDHHC24 constructs, normalizing to expression levels (e.g., via Western blotting) is crucial for accurate activity comparisons .

How can I develop an orthogonal substrate system for specific ZDHHC24 activity monitoring?

Developing an orthogonal substrate system for ZDHHC24 requires a systematic approach:

  • Structure-guided engineering: Based on available structural data from related ZDHHCs, identify amino acids lining the fatty acyl-binding cavity of ZDHHC24 that could be mutated to accommodate synthetic acyl-CoA analogs not recognized by wild-type enzymes .

  • Synthetic acyl-CoA design: Design and synthesize modified acyl-CoA molecules with alterations that prevent utilization by wild-type ZDHHCs but are compatible with the engineered ZDHHC24 mutant.

  • Screening and optimization: Test multiple ZDHHC24 mutant/synthetic acyl-CoA pairs to identify combinations with high selectivity and catalytic efficiency.

  • Validation in cellular systems: Confirm that the orthogonal system functions in cellular contexts by demonstrating selective labeling of ZDHHC24 substrates.

This approach, which has been successfully applied to other enzyme families including protein kinases, methyltransferases, and other transferases, provides a powerful method for exploring ZDHHC24-specific substrate selectivity in complex biological systems .

What are the best approaches to study ZDHHC24 in its native membrane environment?

Studying ZDHHC24 in its native membrane environment is crucial for understanding its authentic biological function. Recommended approaches include:

  • Membrane fraction assays: Prepare whole membrane fractions from cells expressing ZDHHC24 and conduct activity assays directly in this native context. This approach has been successfully applied to other ZDHHCs and avoids artifacts associated with purification .

  • Live-cell imaging: Using fluorescently tagged ZDHHC24 combined with organelle markers can reveal its subcellular localization and dynamics.

  • Proximity labeling: Enzyme-based proximity labeling techniques (BioID, APEX) fused to ZDHHC24 can identify proximal proteins in the native membrane environment.

  • Lipidomic analysis: Characterizing the lipid composition of membranes containing ZDHHC24 can provide insights into how the local lipid environment influences enzyme function.

  • Native membrane patches: Techniques that preserve membrane patches or create giant plasma membrane vesicles can maintain ZDHHC24 in a more native state than detergent solubilization.

These approaches collectively provide a more physiologically relevant understanding of ZDHHC24 function compared to studies using purified components.

How do disease-associated mutations affect ZDHHC24 activity?

While specific disease-associated mutations in ZDHHC24 are not detailed in the provided search results, findings from other ZDHHC family members offer valuable insights into how mutations might affect ZDHHC24:

  • Impact on enzyme activation: Disease-related point mutations in various ZDHHCs can affect their auto-S-palmitoylation capability, which is the necessary first step in the catalytic cycle. This can be assessed using the NBD-palmitoyl-CoA fluorescence assay .

  • Effects on substrate recognition: Mutations might alter ZDHHC24's ability to interact with specific substrate proteins without affecting its auto-palmitoylation activity.

  • Altered subcellular localization: Some mutations could disrupt targeting signals, leading to mislocalization of ZDHHC24 away from its normal cellular compartments (predicted to be Golgi apparatus and endoplasmic reticulum) .

  • Changes in regulatory interactions: Mutations might affect how ZDHHC24 is regulated by post-translational modifications or protein-protein interactions.

To study potential disease-associated mutations in ZDHHC24, researchers should examine both the enzyme's auto-palmitoylation capacity and its ability to palmitoylate known substrates, as mutations may differentially impact these two aspects of enzyme function.

Why might recombinant ZDHHC24 show low or no enzymatic activity in vitro?

Several factors can contribute to low or absent enzymatic activity of recombinant ZDHHC24:

  • Denaturation during purification: The multiple transmembrane domains of ZDHHC24 make it particularly susceptible to denaturation during extraction from membranes. Using milder detergents or native membrane preparations may preserve activity .

  • Loss of cofactors: ZDHHC24 might require specific lipids or protein cofactors present in its native environment but absent in purified systems.

  • Oxidation of catalytic cysteines: The active site cysteine in the DHHC motif is susceptible to oxidation, which would prevent auto-S-palmitoylation. Maintaining reducing conditions throughout purification and assay procedures is essential.

  • Improper folding in expression systems: Overexpression might lead to improper folding or aggregation. Consider using inducible expression systems or lower growth temperatures to promote proper folding.

  • Substrate accessibility: The structure of recombinant ZDHHC24 might differ from its native conformation in ways that limit substrate accessibility to the active site.

A comparative analysis using membrane fractions containing ZDHHC24, rather than purified enzyme, might provide a more reliable assessment of enzymatic activity .

What strategies can improve detection of ZDHHC24-mediated protein palmitoylation?

Enhancing detection of ZDHHC24-mediated protein palmitoylation requires optimized experimental conditions:

  • Clarification spin: Removing nuclei and cell debris through a clarification spin can significantly reduce background noise in fluorescence-based detection methods .

  • Depletion of endogenous acyl-CoA: When using labeled acyl-CoA analogs, depleting endogenous acyl-CoA improves signal-to-noise ratios .

  • Higher concentrations of detection reagents: For ZDHHCs with weaker signals, using increased concentrations of NBD-palmitoyl-CoA (e.g., 25 μM rather than 10 μM) can enhance detection .

  • Optimized solubilization: Using detergents like dodecylphosphocholine (DPC) can improve extraction of palmitoylated membrane proteins while maintaining their solubility .

  • Rapid processing: To protect thioester linkages from deacylation, samples should be processed within approximately 2 days with minimal refreezing cycles .

  • Increased wash steps: During enrichment procedures, additional wash steps can decrease sample complexity and reduce non-specific enrichment, improving confidence in identified ZDHHC24 substrates .

  • Stringent filtering criteria: In proteomics studies, applying filters such as removing proteins with sequence coverage below 5% can increase statistical confidence in identified substrates .

How can I establish substrate specificity between ZDHHC24 and other ZDHHC family members?

Determining the substrate specificity of ZDHHC24 compared to other ZDHHC family members requires systematic approaches:

  • Comparative substrate profiling: Express individual ZDHHCs (including ZDHHC24) in cells and compare the resulting palmitoylated proteomes to identify differentially modified proteins. This can be accomplished using chemical-genetic systems with engineered enzyme-substrate pairs .

  • In vitro competition assays: Using purified enzymes and synthetic substrates, compare the kinetic parameters (Km, kcat) of ZDHHC24 versus other ZDHHCs for specific substrates.

  • Domain swapping experiments: Construct chimeric proteins between ZDHHC24 and other ZDHHCs to identify regions responsible for substrate specificity.

  • Mutational analysis: Systematic mutation of residues in the substrate-binding region of ZDHHC24 can reveal amino acids critical for specific substrate recognition.

  • Cellular colocalization studies: Different ZDHHCs localize to specific subcellular compartments, which contributes to their substrate specificity in vivo. Comparing the localization of ZDHHC24 (predicted to be in Golgi apparatus and endoplasmic reticulum) with other ZDHHCs can provide insights into potential substrate overlap or uniqueness.

This multi-faceted approach can help define the unique substrate profile of ZDHHC24 within the broader ZDHHC enzyme family.

What statistical approaches are most appropriate for analyzing ZDHHC24 substrate identification data?

When analyzing data from ZDHHC24 substrate identification experiments, several statistical approaches are recommended:

  • Fold-change analysis: Compare palmitoylation levels between experimental (ZDHHC24-expressing) and control (catalytically inactive ZDHHC24 or empty vector) conditions, typically applying a threshold of 1.5-2 fold change.

  • Statistical testing: Apply appropriate statistical tests such as Student's t-test for comparing two conditions or one-way ANOVA with Dunnett's or Tukey's post-hoc tests for multiple comparisons .

  • Multiple testing correction: When testing many potential substrates simultaneously, apply corrections for multiple hypothesis testing (e.g., Benjamini-Hochberg procedure) to control false discovery rates.

  • Filtering criteria: Apply filtering criteria such as minimum sequence coverage (e.g., >5%) in proteomics studies to increase confidence in protein identifications .

  • Hierarchical clustering: Group potential substrates based on their palmitoylation patterns across different conditions or ZDHHC family members to identify substrate classes.

  • Pathway enrichment analysis: Analyze identified substrates for enrichment in particular cellular pathways or functions to gain insights into the biological roles of ZDHHC24.

Visualization tools like volcano plots can effectively display both statistical significance and magnitude of changes in palmitoylation levels across the proteome.

How should I interpret apparent contradictions in ZDHHC24 substrate specificity data?

Contradictions in ZDHHC24 substrate specificity data are common and may arise from several factors:

  • Experimental context differences: Results from in vitro vs. cellular studies may differ due to the influence of cofactors, localization, or competing enzymes present in cells but absent in purified systems.

  • Expression level effects: Overexpression of ZDHHC24 may lead to non-physiological substrate modifications that wouldn't occur at endogenous expression levels.

  • Cell type specificity: ZDHHC24 may have different substrate preferences in different cell types due to varying proteomes and regulatory environments.

  • Indirect effects: Some apparent "substrates" may be indirectly affected by ZDHHC24 activity through regulatory cascades rather than direct enzyme-substrate relationships.

  • Technical variables: Differences in sample preparation, detection methods, or data analysis pipelines can lead to apparently contradictory results.

To resolve such contradictions, consider integrating multiple approaches (e.g., combining in vitro validation, proximity-based methods, and mutational analysis) and carefully control for expression levels using appropriate normalization techniques .

What bioinformatic tools can predict potential ZDHHC24 substrates and palmitoylation sites?

Several bioinformatic approaches can help predict potential ZDHHC24 substrates and palmitoylation sites:

  • Sequence-based prediction: Tools like CSS-Palm, PalmPred, and NBA-Palm analyze protein sequences to predict potential S-palmitoylation sites based on known motifs and amino acid properties surrounding cysteine residues.

  • Structural prediction: Software that identifies surface-exposed cysteines in protein structures can help prioritize potential palmitoylation sites.

  • Evolutionary conservation analysis: Cysteines that are conserved across species are more likely to be functionally important and potential palmitoylation sites.

  • Protein-protein interaction networks: Analysis of known interaction partners of ZDHHC24 can suggest potential substrates, as physical proximity is often required for palmitoylation.

  • Co-expression analysis: Proteins that show similar expression patterns to ZDHHC24 across tissues or conditions may be functionally related and potential substrates.

How does ZDHHC24 function differ between mouse models and human systems?

While the search results provide limited direct comparison between mouse and human ZDHHC24, some general considerations apply:

  • Evolutionary conservation: Mouse ZDHHC24 is orthologous to human ZDHHC24 , suggesting conserved core functions between species. The DHHC domain that defines this enzyme family is highly conserved across evolution.

  • Expression patterns: Potential differences in tissue-specific expression patterns between mouse and human ZDHHC24 may exist, which could impact its biological roles in different tissues.

  • Substrate availability: Different substrate proteins may be expressed in mouse versus human tissues, leading to species-specific palmitoylation targets despite conserved enzyme activity.

  • Regulatory mechanisms: Post-translational modifications or protein-protein interactions regulating ZDHHC24 activity might differ between species.

When using mouse models to study ZDHHC24 with the intention of translating findings to human systems, researchers should validate key observations in human cells or tissues where possible. Careful attention to species differences in experimental design and interpretation can enhance the translational relevance of ZDHHC24 research.

What are the implications of ZDHHC24 dysregulation in disease models?

While specific disease associations of ZDHHC24 are not detailed in the provided search results, findings from other ZDHHC family members suggest potential implications:

  • Cancer biology: Various point mutations within individual ZDHHCs have been associated with particular cancers, affecting their catalytic capacity . Similar mutations in ZDHHC24 might contribute to tumor cell biology.

  • Neurological disorders: Several ZDHHCs have established roles in neuronal function and development, with mutations linked to neurological conditions. ZDHHC24 dysregulation might similarly impact neuronal homeostasis.

  • Metabolic regulation: Palmitoylation influences the function of numerous metabolic enzymes and signaling molecules, suggesting potential roles for ZDHHC24 in metabolic disorders.

  • Immune function: Protein palmitoylation regulates various aspects of immune cell signaling and function, indicating possible implications of ZDHHC24 dysregulation in inflammatory or immune disorders.

When investigating ZDHHC24 in disease contexts, researchers should consider both loss-of-function and gain-of-function scenarios, as well as potential compensatory mechanisms involving other ZDHHC family members.

How can ZDHHC24 research contribute to therapeutic development strategies?

Research on ZDHHC24 can inform therapeutic development in several ways:

  • Target identification: Identification of ZDHHC24 substrates involved in disease processes could reveal novel therapeutic targets. The chemical-genetic and orthogonal substrate approaches detailed in the search results provide powerful methods for such substrate discovery .

  • Small molecule development: Understanding the structure and catalytic mechanism of ZDHHC24 could enable design of specific inhibitors or activators. Structure-guided engineering approaches used for other ZDHHCs could inform this process .

  • Biomarker discovery: Changes in ZDHHC24 expression or activity might serve as biomarkers for certain disease states or treatment responses.

  • Gene therapy approaches: In conditions where ZDHHC24 function is compromised, gene therapy to restore proper expression might be considered.

  • Substrate-targeted interventions: Rather than targeting ZDHHC24 directly, interventions might aim to mimic or reverse the effects of palmitoylation on specific disease-relevant substrates.

The developing toolkit for studying ZDHHC specificity, including chemical-genetic systems and orthogonal enzyme-substrate pairs , provides powerful approaches for validating ZDHHC24 as a potential therapeutic target and understanding the downstream consequences of modulating its activity.

What are the most promising techniques for advancing our understanding of ZDHHC24 biology?

Several cutting-edge approaches hold particular promise for advancing ZDHHC24 research:

  • Chemical-genetic systems: Further development of paired ZDHHC24 "hole" mutants and "bumped" chemically tagged fatty acid probes will enable more precise mapping of ZDHHC24-specific substrates in various cellular contexts .

  • Orthogonal enzyme-substrate design: Continued refinement of synthetic fatty acyl-CoA analogs selectively used by engineered ZDHHC24 variants will provide powerful tools for dissecting substrate specificity .

  • Cryo-EM structural studies: Determining the high-resolution structure of ZDHHC24 would significantly advance understanding of its mechanism and substrate specificity.

  • CRISPR-based approaches: Genome editing to create endogenously tagged or mutated ZDHHC24 can provide more physiologically relevant models than overexpression systems.

  • Single-cell proteomics: Emerging techniques for analyzing protein modifications at the single-cell level could reveal cell-type-specific functions of ZDHHC24.

  • Integrative multi-omics: Combining proteomic, transcriptomic, and metabolomic analyses in ZDHHC24-modulated systems can provide comprehensive understanding of its biological impact.

These approaches collectively promise to elucidate the specific biological roles of ZDHHC24 within the broader context of protein S-acylation biology.

What unresolved questions about ZDHHC24 represent the highest research priorities?

Several key questions about ZDHHC24 remain to be addressed:

  • Substrate specificity determinants: What structural features or interaction domains of ZDHHC24 determine its specific substrate preferences compared to other ZDHHC family members?

  • Regulatory mechanisms: How is ZDHHC24 activity regulated by post-translational modifications, protein-protein interactions, or changes in subcellular localization?

  • Tissue-specific functions: Does ZDHHC24 serve different roles in different tissues, and what are its physiologically relevant substrates in each context?

  • Disease relevance: Are there specific human diseases associated with ZDHHC24 mutations or dysregulation, and what mechanisms underlie these associations?

  • Evolutionary conservation: How conserved is ZDHHC24 function across species, and what can comparative studies reveal about its fundamental biological roles?

  • Integration with other PTMs: How does ZDHHC24-mediated palmitoylation interact with other post-translational modifications to create complex regulatory networks?

Addressing these questions will require interdisciplinary approaches combining biochemistry, cell biology, structural biology, and systems-level analyses.

How can collaborative research approaches accelerate ZDHHC24 research?

Advancing ZDHHC24 research will benefit from collaborative approaches that:

  • Establish standardized reagents and protocols: Development of validated antibodies, recombinant proteins, and assay protocols that can be widely shared would enhance data comparability across studies.

  • Create comprehensive substrate databases: Collaborative efforts to catalog ZDHHC24 substrates identified across different experimental systems would facilitate meta-analyses and systems-level understanding.

  • Coordinate structural biology initiatives: Due to the technical challenges of membrane protein structural studies, coordinated efforts across multiple laboratories could accelerate determination of ZDHHC24 structure.

  • Integrate diverse expertise: Combining expertise from biochemistry, cell biology, computational biology, and clinical research would provide complementary perspectives on ZDHHC24 function.

  • Develop shared animal models: Creation and characterization of ZDHHC24 knockout or knockin mouse models that can be distributed to multiple research groups would enhance reproducibility and enable diverse phenotypic analyses.

  • Implement open science practices: Rapid sharing of protocols, reagents, and primary data would accelerate discovery and reduce redundant efforts across the research community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.