Recombinant Mouse Probable palmitoyltransferase ZDHHC4 (Zdhhc4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Palmitoylation

Zdhhc4 regulates substrate trafficking and degradation via palmitoylation. Key findings include:

Mechanistic Insights:

  • TRPV1 Regulation: Zdhhc4 interacts with transient receptor potential vanilloid 1 (TRPV1), catalyzing palmitoylation at residues Cys157, Cys362, Cys390, and Cys715. This modification promotes TRPV1 lysosomal degradation, resolving inflammatory pain .

  • Enzymatic Activity: Overexpression reduces TRPV1 surface levels by 40–60%, while shRNA knockdown increases TRPV1 stability .

  • Dynamic Control: Depalmitoylase APT1 reverses Zdhhc4-mediated modifications, creating a regulatory loop .

Key Experimental Uses

ApplicationModel SystemOutcome
TRPV1 Trafficking StudiesHEK293T/ND7/23 cellsConfirmed colocalization via BiFC imaging and co-IP .
Pain Mechanism AnalysisMouse DRG neuronsZdhhc4 upregulation correlates with TRPV1 degradation during pain resolution .
Enzyme KineticsIn vitro assaysABE (acyl-biotin exchange) assays quantify palmitoylation efficiency .

Mutational Analysis

Critical Residues in TRPV1:

MutationEffect on Zdhhc4 Activity
C157A↓ Palmitoylation by 30%
C362A↓ Protein degradation
C390AImpaired lysosomal targeting
C715ALoss of current density reduction
4CA (Quadruple mutant)Complete loss of Zdhhc4 regulation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Zdhhc4; Palmitoyltransferase ZDHHC4; Zinc finger DHHC domain-containing protein 4; DHHC-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc4
Target Protein Sequence
MDFLVLFLFYLAFLLICVVLICIFTKSQRLKAVVLGGAQVCSRVIPQCLQRAVQTLLHQL FHTRHPTFIVLHLLLQGLVYAEYTCEVFGYCRELEFSLPYLLLPYVLLSVNLVFFTLTCA ANPGTITKANESFLLQVYKFDDVMFPKNSRCPTCDLRKPARSKHCRLCDRCVHRFDHHCV WVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAV DTVFLIQHLFLAFPRIVFLLGFVIVLSMLLAGYLCFALYLAATNQTTNEWYKGDWAWCQR WPLVAWSPSAEPRIHQNIHSHGFRSNLREIFLPATPSYKKKEK
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate to protein substrates, including the D2 dopamine receptor (DRD2).
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ZDHHC4 in mice and how does it compare to human ZDHHC4?

ZDHHC4 belongs to the ZDHHC family of palmitoyl transferases that catalyze protein S-palmitoylation, a post-translational lipid modification that regulates protein stability and cellular distribution. While human ZDHHC4 is encoded on chromosome 7, mouse Zdhhc4 shares significant homology but may exhibit tissue-specific expression patterns. S-palmitoylation has been widely reported in neuronal systems, with growing evidence for its role in immune pathways and cancer progression . When investigating mouse Zdhhc4, researchers should conduct comparative sequence analysis between species to identify conserved domains that may indicate functional significance.

What expression systems are most effective for producing recombinant mouse ZDHHC4 protein?

Escherichia coli remains one of the most widely used expression systems for recombinant proteins due to its rapid growth rate, relatively inexpensive substrates, well-established genetic background, and availability of commercial vectors . For mouse Zdhhc4 expression, the following parameters should be optimized:

ParameterRecommended RangeNotes
Growth mediumDefined medium with 1.0-1.4% yeast extractSupports higher cell density
Induction pointMid-exponential phase (OD600 0.4-0.6)Balances growth with expression capacity
Induction temperature25-30°CLower temperatures often increase soluble protein yield
IPTG concentration0.1-0.5 mMHigher concentrations may lead to inclusion bodies
Post-induction time4-6 hoursLonger times may reduce productivity

Statistical experimental design methodology is highly recommended for optimizing these parameters simultaneously rather than the traditional one-variable-at-a-time approach, as multivariant methods enable characterization of experimental error and comparison of variable effects .

What purification strategies are most effective for recombinant mouse ZDHHC4?

Purification of recombinant mouse Zdhhc4 typically involves a multi-step process designed to maintain protein solubility and enzymatic activity. Since ZDHHC4 is a membrane-associated enzyme, consider these approaches:

  • Cell lysis using mild detergents (e.g., 0.5-1% CHAPS or NP-40) to solubilize the protein while preserving structure

  • Affinity chromatography using His-tag or GST-tag depending on your expression construct

  • Size exclusion chromatography to improve purity

  • Ion exchange chromatography as a polishing step

The purification protocol should be optimized to achieve at least 75% homogeneity while maintaining functional activity, similar to what has been achieved with other recombinant proteins . Activity assays should be performed at each purification step to monitor retention of enzymatic function.

How can I design experiments to assess the substrate specificity of mouse ZDHHC4 compared to other ZDHHC family members?

Developing a comprehensive substrate specificity profile for mouse Zdhhc4 requires a methodical approach:

  • Comparative enzymatic assays: Utilize recombinant mouse Zdhhc4 alongside other ZDHHC family members (particularly ZDHHC3 which has been well-characterized) with fluorescently labeled palmitoyl-CoA and potential substrate proteins.

  • Substrate validation: Apply the following workflow to identify and validate substrates:

Experimental ApproachExpected OutcomeAnalysis Method
Mass spectrometry-based proteomicsIdentification of palmitoylated proteinsAcyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC)
Palmitoylation site mappingDetermination of specific cysteine residuesClick chemistry with alkyne-palmitate followed by MS/MS
Mutagenesis studiesConfirmation of functional palmitoylation sitesSite-directed mutagenesis of candidate cysteines
Inhibitor studiesDifferential sensitivity profiles2-bromopalmitate (2-BP) dose-response curves
  • Bioinformatic analysis: Compare substrate preferences against other ZDHHC family members to identify unique targeting motifs surrounding palmitoylation sites.

This multilayered approach provides a more robust understanding of Zdhhc4's biological role compared to other family members like ZDHHC3, which has been implicated in pancreatic cancer progression .

What are the methodological considerations for investigating the role of ZDHHC4 in mouse disease models?

When investigating Zdhhc4's role in disease pathogenesis, consider these methodological approaches:

  • Gene manipulation strategies:

    • CRISPR/Cas9-mediated knockout of Zdhhc4 in mice

    • Conditional knockout systems (e.g., Cre-loxP) for tissue-specific deletion

    • Knockdown approaches using shRNA for partial suppression

  • Phenotypic analysis framework:

    • Molecular characterization: Changes in palmitoylation profiles of target proteins

    • Cellular phenotypes: Alterations in protein localization, stability, and signaling

    • Tissue-specific effects: Focus on tissues with high Zdhhc4 expression

    • Whole-organism phenotypes: Development, behavior, and disease susceptibility

  • Translational relevance assessment:

    • Compare phenotypes to human disease correlates

    • Evaluate potential as therapeutic target using inhibitors like 2-bromopalmitate (2-BP)

Drawing from research on ZDHHC3 in pancreatic cancer, where genetic inactivation impeded tumor progression and enhanced anti-tumor immunity , similar approaches could be applied to investigate Zdhhc4's role in relevant disease models.

How can contradictory results in ZDHHC4 functional studies be reconciled and addressed experimentally?

Contradictory findings in Zdhhc4 research may arise from multiple factors including:

  • Technical variations:

    • Expression systems (bacterial vs. mammalian)

    • Protein tags affecting folding or function

    • Assay conditions (detergents, buffers, temperature)

  • Biological complexities:

    • Functional redundancy among ZDHHC family members

    • Tissue-specific effects or compensatory mechanisms

    • Context-dependent substrate interactions

To address these contradictions experimentally:

  • Standardization approach:

    • Use multiple expression systems in parallel

    • Test both N- and C-terminal tags

    • Compare activity across standardized conditions

  • Validation framework:

    • Cross-validate findings using complementary techniques

    • Implement both in vitro and in vivo models

    • Utilize CRISPR/Cas9 to generate clean genetic models

  • Contextual analysis:

    • Examine Zdhhc4 in the context of other ZDHHC enzymes

    • Assess tissue-specific expression patterns

    • Evaluate developmental stage-specific functions

This systematic approach enables reconciliation of seemingly contradictory results by identifying the specific conditions under which particular functions of Zdhhc4 are manifested.

What experimental design approach is optimal for maximizing soluble expression of recombinant mouse ZDHHC4?

To maximize soluble expression of recombinant mouse Zdhhc4, implement a statistical experimental design methodology rather than changing one variable at a time. This multivariant approach allows estimation of statistically significant variables while accounting for interactions between them .

Follow this implementation workflow:

  • Factorial design setup:

    • Identify key variables (temperature, inducer concentration, media composition, etc.)

    • Establish a fractional factorial screening design (e.g., 2^8-4 for eight variables)

    • Include central point replicates to detect curvature effects

  • Optimization parameters:

    • Cell growth (OD600)

    • Soluble protein yield (quantified by Western blot)

    • Enzymatic activity (palmitoylation assays)

    • Productivity (yield per unit time)

  • Analytical progression:

    • Analyze main effects and interactions

    • Build regression models

    • Identify optimal conditions

    • Validate with confirmation runs

For E. coli expression systems, induction in mid-exponential phase typically yields better results than late exponential or stationary phases, as demonstrated in similar recombinant protein expression studies . This statistical approach can increase soluble Zdhhc4 yields from typical levels (10-50 mg/L) to potentially 250 mg/L or higher, similar to improvements seen with other recombinant proteins .

What are the key considerations for developing robust activity assays for mouse ZDHHC4?

Developing reliable activity assays for mouse Zdhhc4 requires addressing several methodological challenges:

  • Assay design considerations:

    • Substrate selection (known vs. predicted substrates)

    • Reaction conditions (detergents, pH, temperature)

    • Detection methods (radioactive, fluorescent, antibody-based)

  • Recommended assay formats:

Assay TypeMethodologyAdvantagesLimitations
Radioactive[³H]-palmitate incorporationHigh sensitivity, gold standardSafety concerns, specialized equipment needed
Click chemistryAlkyne-palmitate labeling with azide fluorophoresNo radioactivity, compatible with imagingPotential interference with enzyme kinetics
ABE/acyl-RACHydroxylamine-mediated exchange of palmitoyl for biotinDetects endogenous palmitoylationIndirect measure, multiple steps
FRET-basedFluorescent substrate proximity changesReal-time kinetics, high-throughputComplex design, potential artifacts
  • Validation criteria:

    • Linearity within physiological concentration ranges

    • Reproducibility (intra- and inter-assay CV <15%)

    • Specificity (confirmed with knockouts/inhibitors)

    • Sensitivity (detection limits appropriate for expected activity)

Each assay format should be calibrated using known ZDHHC family members (such as ZDHHC3) as comparative controls, and multiple complementary approaches should be employed to build confidence in activity measurements .

How can bioinformatic approaches enhance functional characterization of mouse ZDHHC4?

Bioinformatic methodologies provide valuable insights for characterizing mouse Zdhhc4 function:

  • Sequence-based analyses:

    • Multiple sequence alignment of ZDHHC family members across species

    • Identification of conserved catalytic domains and regulatory regions

    • Prediction of post-translational modification sites that may regulate Zdhhc4 activity

  • Structural modeling and docking:

    • Homology modeling based on related protein structures

    • Substrate binding pocket characterization

    • In silico docking of potential substrates and inhibitors

  • Expression correlation analyses:

    • Integration of transcriptomic data across tissues and conditions

    • Co-expression network analysis to identify functional relationships

    • Correlation with potential substrate expression patterns

  • Pathway enrichment methodologies:

    • Gene Ontology (GO) term enrichment of co-expressed genes

    • KEGG pathway analysis of potential substrates

    • Comparison with datasets from other ZDHHC family members

Similar to the approach used for ZDHHC3 in pancreatic cancer research, implementing tools like GSEA (Gene Set Enrichment Analysis) and KEGG pathway analysis can reveal biological processes most relevant to Zdhhc4 function . This bioinformatic framework complements experimental approaches and provides direction for targeted validation studies.

How might insights from mouse ZDHHC4 research inform understanding of human disease mechanisms?

Translating findings from mouse Zdhhc4 to human disease contexts requires careful consideration of several factors:

  • Comparative biology framework:

    • Sequence conservation analysis between mouse and human ZDHHC4

    • Tissue expression pattern comparison using databases like Human Protein Atlas and Mouse Genome Informatics

    • Substrate conservation evaluation across species

  • Disease association methodology:

    • Analysis of ZDHHC4 expression in human disease tissues using TCGA data

    • Examination of SNPs or mutations in human ZDHHC4 associated with disease

    • Correlation of palmitoylation changes with disease progression

  • Therapeutic potential assessment:

    • Evaluation of ZDHHC4 as a potential drug target

    • Comparison with other ZDHHC family members with established disease roles

    • Development of selective inhibitors based on structural information

Research on ZDHHC3 has demonstrated its critical oncogenic role in pancreatic cancer progression and highlighted its potential as an immunotherapeutic target . Similar methodological approaches could reveal whether ZDHHC4 plays comparable roles in specific disease contexts, potentially identifying new therapeutic opportunities.

What experimental approaches can determine if ZDHHC4 affects immune response pathways similar to other ZDHHC family members?

To investigate potential immunomodulatory functions of Zdhhc4, implement these experimental approaches:

  • Immune cell phenotyping:

    • Flow cytometry analysis of immune populations in Zdhhc4 knockout/knockdown models

    • Assessment of activation markers on T cells, B cells, macrophages, and dendritic cells

    • Evaluation of cytokine production profiles

  • Functional immune assays:

    • T cell proliferation and cytotoxicity assays

    • Macrophage phagocytosis and polarization studies

    • Dendritic cell antigen presentation capacity

  • In vivo immune challenge models:

    • Response to pathogen challenge in Zdhhc4-deficient mice

    • Tumor growth and response to immunotherapy

    • Autoimmune disease susceptibility

  • Molecular pathway analysis:

    • Evaluation of key signaling pathways (NF-κB, STAT, MAPK)

    • Assessment of immune checkpoint molecule expression

    • Analysis of palmitoylation status of immune receptors

Research on ZDHHC3 has shown that it promotes an immunosuppressive tumor microenvironment in pancreatic cancer, and its inhibition enhances anti-tumor immunity and improves response to immune checkpoint blockade therapy . Similar methodological approaches could determine whether Zdhhc4 also influences immune response pathways and potential therapeutic applications.

How can researchers effectively compare data across different mouse models when studying ZDHHC4 function?

Effective cross-model comparison requires standardized methodologies and careful documentation:

  • Standardization parameters:

    • Genetic background documentation (strain, generation, breeding scheme)

    • Age and sex matching across experiments

    • Consistent environmental conditions (housing, diet, microbiome)

    • Standardized experimental protocols and reagents

  • Data integration framework:

    • Multi-omics approach (transcriptomics, proteomics, metabolomics)

    • Consistent bioinformatic pipelines for analysis

    • Meta-analysis methodology for comparing across studies

    • Shared data repositories and standardized formats

  • Validation strategies:

    • Independent replication in different laboratories

    • Use of multiple model systems (knockout, knockdown, overexpression)

    • Cross-validation with human data where available

  • Statistical considerations:

    • Power analysis to determine appropriate sample sizes

    • Correction for multiple comparisons

    • Transparent reporting of all statistical methods and raw data

What are the most effective strategies for troubleshooting low yields or activity loss in recombinant mouse ZDHHC4 preparations?

When encountering challenges with recombinant mouse Zdhhc4 expression, implement this systematic troubleshooting approach:

  • Expression optimization matrix:

IssuePotential CausesInterventionsSuccess Indicators
Low expression yieldCodon bias, toxicityCodon optimization, tight promoter controlIncreased protein bands on SDS-PAGE
Inclusion body formationRapid expression, improper foldingLower temperature, slower inductionIncreased protein in soluble fraction
Proteolytic degradationHost proteasesProtease inhibitors, protease-deficient strainsIntact protein bands
Activity lossImproper folding, cofactor absenceChaperone co-expression, addition of zincRecovery of enzymatic activity
  • Solubility enhancement strategies:

    • Fusion partners (MBP, SUMO, thioredoxin)

    • Solubility-enhancing mutations identified through directed evolution

    • Co-expression with interacting partners or chaperones

  • Activity preservation methods:

    • Buffer optimization (detergent type/concentration, pH, ionic strength)

    • Addition of stabilizing agents (glycerol, reducing agents)

    • Flash-freezing in small aliquots to minimize freeze-thaw cycles

This structured approach addresses both yield and activity challenges, similar to methods that have successfully improved expression of other challenging recombinant proteins to levels of 250 mg/L or higher .

How can mass spectrometry approaches be optimized for studying mouse ZDHHC4-mediated protein palmitoylation?

To optimize mass spectrometry (MS) for detecting and quantifying Zdhhc4-mediated palmitoylation:

  • Sample preparation optimization:

    • Efficient palmitoylated protein enrichment (ABE, acyl-RAC)

    • Careful detergent removal prior to MS analysis

    • Optimized trypsin digestion conditions for membrane proteins

  • MS method development:

    • Targeted approaches for known substrates (PRM, MRM)

    • Discovery approaches for novel substrates (DDA, DIA)

    • Specialized fragmentation methods (ETD, EThcD) for improved site localization

  • Data analysis pipeline:

    • Custom search parameters for palmitoylation modifications

    • Site localization scoring algorithms

    • Quantitative comparison between experimental conditions

  • Validation methodology:

    • Synthetic peptide standards for palmitoylated sequences

    • Parallel analysis using orthogonal techniques

    • Site-directed mutagenesis of putative palmitoylation sites

These methodological considerations enhance the detection sensitivity and quantification accuracy for palmitoylated proteins, facilitating more robust characterization of Zdhhc4's substrate specificity and activity similar to approaches applied to other ZDHHC family members in cancer research .

What considerations are important when designing inhibitor studies targeting mouse ZDHHC4?

When developing or implementing inhibitor studies for mouse Zdhhc4:

  • Inhibitor selection framework:

    • Broad-spectrum inhibitors (e.g., 2-bromopalmitate) for initial studies

    • ZDHHC family-selective compounds where available

    • Development of Zdhhc4-specific inhibitors based on structural information

  • Study design considerations:

    • Dose-response relationships (IC50 determination)

    • Time-course studies to assess temporal effects

    • Washout experiments to determine reversibility

    • Combination with genetic approaches for validation

  • Specificity validation methods:

    • Counter-screening against other ZDHHC family members

    • Evaluation of off-target effects on other lipid-modifying enzymes

    • Assessment of general cellular toxicity

    • In silico docking to predict binding modes

  • Translational potential assessment:

    • Pharmacokinetic and pharmacodynamic studies in vivo

    • Biomarker development for target engagement

    • Combination therapy approaches (e.g., with immunotherapy)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.