Recombinant Mouse Progestin and adipoQ receptor family member 3 (Paqr3)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Production

Recombinant mouse PAQR3 is synthesized using heterologous expression systems. Key platforms include:

Table 1: Expression Systems for Recombinant PAQR3

Host SystemTagPurityApplicationsSource
Tobacco (N. tabacum)Strep Tag>80%Functional assays, ELISA
E. coliHis Tag>90%Structural studies, AP
Wheat GermGST Tag>80%WB, affinity purification
  • Purification: Affinity chromatography (e.g., glutathione resin for GST tags) .

  • Storage: -80°C in Tris-HCl or glutathione buffer to prevent degradation .

Functional Roles in Cellular Processes

Recombinant PAQR3 is pivotal in studying:

Autophagy Regulation

  • Scaffolds the ATG14L–Beclin1–VPS34 complex to enhance PI(3)P production during glucose starvation .

  • Phosphorylation at Thr32 by AMPK activates autophagosome formation .

Tumor Suppression

  • Inhibits PI3K/AKT signaling, reducing proliferation in glioma and NSCLC cells .

  • Downregulation correlates with poor prognosis in cancer models .

Cholesterol and Lipid Homeostasis

  • Anchors Scap/SREBP complexes to the Golgi, promoting cholesterol biosynthesis .

  • Regulates hepatic PPARα ubiquitination to modulate lipid catabolism .

Diabetic Nephropathy

  • Upregulates fibronectin and ICAM-1 via NF-κB in hyperglycemic conditions .

Table 2: Notable Studies Using Recombinant PAQR3

Study FocusModel SystemKey OutcomeReference
Autophagy initiationHEK293 cellsPAQR3 phosphorylation by AMPK boosts PI(3)P
Glioma progressionU251 cellsPAQR3 overexpression reduces PI3K/AKT activity
Cholesterol biosynthesisSRD-13A cellsPAQR3 anchors Scap/SREBP to Golgi
Diabetic renal fibrosisSTZ-induced micePAQR3 silencing reduces NF-κB activation

Research Applications

  • Mechanistic Studies: Elucidating PAQR3’s role in autophagy, cancer, and metabolism .

  • Drug Development: Screening inhibitors targeting PAQR3–Scap/SREBP interactions .

  • Diagnostic Tools: Detecting PAQR3 levels in disease models via ELISA/WB .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
Paqr3; Progestin and adipoQ receptor family member 3; Progestin and adipoQ receptor family member III; Raf kinase trapping to Golgi; RKTG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Paqr3
Target Protein Sequence
MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPVSLKDNPYITDGYRAYLPSRLCI KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCML CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA MILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRV IVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVMLYWWHQSTVYVMQYRH SKPCPDYVSHL
Uniprot No.

Target Background

Function

PAQR3 functions as a spatial regulator of RAF1 kinase, sequestering it to the Golgi apparatus.

Gene References Into Functions

PAQR3 Function and Associated Studies:

  1. PAQR3 regulates cholesterol homeostasis by anchoring Scap/SREBP to the Golgi; disruption of this function reduces cholesterol biosynthesis. PMID: 26311497
  2. PAQR3 plays a significant physiological role in modulating obesity, energy metabolism, and leptin signaling. PMID: 24035996
  3. PAQR3 negatively regulates insulin signaling by directing cytosolic p110α to the Golgi apparatus, while competing with the p85 subunit in forming a PI3K complex with p110α. PMID: 23086038
  4. Loss of PAQR3 is linked to colorectal cancer tumorigenesis. PMID: 22828136
  5. PAQR3 spatially regulates Raf kinase activity by sequestering Raf-1 to the Golgi, thereby inhibiting the ERK signaling pathway. PMID: 17724343
  6. PAQR3 exhibits suppressive activity in chemical carcinogen-induced mitogenesis and tumor formation in mouse skin. PMID: 18550569
Database Links
Protein Families
ADIPOR family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of recombinant mouse PAQR3?

Recombinant mouse PAQR3 is typically expressed as a 311 amino acid protein with various epitope tags for detection and purification. The full amino acid sequence of mouse PAQR3 (AA 1-311) is:

MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPVSL KDNPYITDGY RAYLPSRLCI KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA SREDFVICSI CLFCFQVCML CSVGYHLFSC HRSEKTCRRW MALDYAGISI GILGCYVSGV FYAFYCNNYW RQVYLITVLA MILAVFFAQI HPSYLTQQWQ RLRPIIFCSV SGYGVIPTLH WVWLNGGVSA PIVQDFAPRV IVMYVIALLA FLFYISKVPE RYFPGQLNYL GSSHQIWHVL AVVMLYWWHQ STVYVMQYRH SKPCPDYVSH L

Structurally, PAQR3 belongs to the progestin and adipoQ receptor family, which shares homology with membrane-associated progesterone receptors and adiponectin receptors. The protein contains multiple transmembrane domains that anchor it to the Golgi apparatus membrane, with both N and C termini facing the cytoplasm.

What expression systems are optimal for producing functional recombinant mouse PAQR3?

Several expression systems have been validated for recombinant mouse PAQR3 production, each with distinct advantages:

Expression SystemPurityTagsApplicationsNotes
HEK-293 Cells>90%His tagELISA, WB, analytical SEC (HPLC)Mammalian expression provides proper folding and post-translational modifications
Cell-free protein synthesis (CFPS)70-80%Strep TagELISA, WB, SDS-PAGERapid production without cellular constraints

For functional studies investigating protein-protein interactions or enzymatic activity, mammalian expression systems like HEK-293 cells are preferable as they maintain proper protein folding and post-translational modifications critical for PAQR3 function. The cell-free protein synthesis system offers advantages for rapid screening but may have limitations for certain functional assays due to potentially incomplete modifications.

How can researchers verify the purity and identity of recombinant PAQR3?

Validation of recombinant PAQR3 should employ multiple complementary approaches:

  • SDS-PAGE/Western blotting: Using specific anti-PAQR3 antibodies or tag-specific antibodies (anti-His, anti-Strep) to confirm molecular weight and immunoreactivity.

  • Analytical SEC (HPLC): To assess protein homogeneity and quaternary structure.

  • Mass spectrometry: For definitive confirmation of protein identity and to identify any post-translational modifications.

  • Functional assays: Particularly those measuring PAQR3's ability to facilitate ATG14L-VPS34 complex formation in autophagy assays.

Most recombinant preparations achieve purity levels of 70-90% as determined by SDS-PAGE, Western Blot, and analytical SEC (HPLC) . For critical applications, researchers should consider additional purification steps if higher purity is required.

What is PAQR3's role in autophagy regulation and how can it be experimentally assessed?

PAQR3 plays a pivotal role in autophagy initiation by facilitating the formation of the ATG14L-associated VPS34 complex . This function is particularly critical during metabolic stress conditions such as glucose starvation.

Methodological approach for studying PAQR3's role in autophagy:

  • Assess autophagosome formation: Monitor GFP-LC3 puncta formation in PAQR3 knockout or knockdown cells compared to control cells under basal and starvation conditions.

  • Analyze PI(3)P production: Examine the formation of GFP-DFCP1 and WIPI1 puncta, which are downstream effectors of PI(3)P generated by the VPS34 complex .

  • Examine complex formation: Use co-immunoprecipitation to assess the interaction between Beclin1, ATG14L, VPS34, and VPS15 in the presence or absence of PAQR3.

  • Functional rescue experiments: Re-express wild-type PAQR3 or phosphorylation mutants (particularly T32 mutants) in PAQR3-deficient cells to determine which domains are essential for autophagy regulation.

PAQR3 deficiency significantly impairs the formation of GFP-DFCP1-positive puncta and the punctiform distribution of WIPI1 during glucose starvation, indicating reduced class III PI3K activity . This demonstrates PAQR3's essential role in activating the class III PI3K complex during autophagy initiation.

How does AMPK signaling integrate with PAQR3 function during autophagy?

AMPK phosphorylates PAQR3 at threonine 32 (T32) upon glucose starvation in an ATG14L-dependent manner . This phosphorylation event is crucial for activating the ATG14L-linked class III PI3K and initiating autophagy.

Experimental approach to study PAQR3 phosphorylation:

  • Phospho-specific antibodies: Develop and validate antibodies recognizing phosphorylated T32 in PAQR3.

  • Phosphorylation-deficient mutants: Create T32A mutants that cannot be phosphorylated and assess their ability to rescue autophagy defects in PAQR3-deficient cells.

  • AMPK inhibition/activation: Use compound C (AMPK inhibitor) or AICAR/metformin (AMPK activators) to modulate AMPK activity and assess effects on PAQR3 phosphorylation and function.

  • In vitro kinase assays: Perform in vitro kinase assays with purified AMPK and recombinant PAQR3 to confirm direct phosphorylation.

This AMPK-PAQR3-VPS34 signaling axis represents a critical mechanism for integrating nutrient sensing with autophagy regulation, highlighting the importance of PAQR3 as a molecular bridge between upstream kinase signaling and downstream autophagy machinery .

What are the phenotypic consequences of PAQR3 deletion in mouse models?

PAQR3 knockout mice exhibit several phenotypes related to autophagy deficiency, particularly neurological abnormalities:

  • Motor function deficits: PAQR3-deleted mice display:

    • Reduced stability on accelerating rotarod tests

    • Increased limb clasping behavior

    • Abnormal paw print intensity and dispersion indicating ataxic walking patterns

    • Significantly weaker limb grip strength compared to wild-type mice

  • Molecular alterations: In PAQR3 knockout mouse tissues:

    • Reduced interaction between Beclin1 and ATG14L, VPS34, and VPS15 in liver tissues

    • Diminished association of ATG14L with other components of the Beclin1-VPS34-VPS15 complex

    • Unaltered association of UVRAG with Beclin1, indicating specificity to the ATG14L-linked complex

  • Exercise-induced autophagy: PAQR3-deleted mice show deficiencies in exercise-induced autophagy, suggesting impaired stress-responsive autophagy activation .

These findings establish PAQR3 as an important regulator of autophagy in vivo, with potential implications for neurodegenerative disorders. Researchers should consider these phenotypes when designing studies using PAQR3 knockout models, particularly for investigations into neurological function.

How does PAQR3 differentially regulate class I versus class III PI3K activity?

PAQR3 functions as a dual modulator with opposite effects on different PI3K classes:

PI3K ClassPAQR3's EffectMechanismBiological Outcome
Class I PI3KNegative regulatorBlocks interaction between p110α and p85Limits growth factor signaling and abnormal proliferation
Class III PI3KPositive regulatorFacilitates formation of ATG14L-VPS34 complexPromotes autophagosome formation and cellular homeostasis

This dual regulatory role positions PAQR3 as a molecular switch that can balance cell growth and homeostasis . During nutrient-rich conditions, PAQR3 can limit excessive growth signaling through class I PI3K inhibition, while under stress conditions, it can promote survival through enhanced class III PI3K/autophagy activation.

Methodological approaches to study this dual regulation:

  • Phosphorylation-specific interactions: Investigate how AMPK-mediated phosphorylation of PAQR3 affects its interaction with class I versus class III PI3K components.

  • Domain mapping: Identify which domains of PAQR3 are responsible for interaction with different PI3K complexes.

  • Cellular localization: Determine if subcellular localization (Golgi versus other compartments) influences PAQR3's differential effects on PI3K classes.

This unique dual regulatory capacity makes PAQR3 an attractive therapeutic target for conditions involving dysregulated growth signaling and/or impaired autophagy.

What is the relationship between PAQR3 and other PAQR family members in different biological contexts?

Within the PAQR family, functional specialization exists:

  • PAQR2 (AdipoR2): Functions as a receptor for C1q/TNF-related protein 3 (CTRP3) in chondrogenic cells, promoting cell proliferation .

  • PAQR3: Specializes in autophagy regulation through interactions with the ATG14L-VPS34 complex .

  • PAQR1/3/4: Unlike PAQR2, inhibition of PAQR1, PAQR3, or PAQR4 does not suppress CTRP3-induced chondrogenic cell proliferation, indicating functional divergence within the family .

  • Expression patterns: PAQR family members show distinct tissue expression patterns. For example, AdipoR1 and AdipoR2 are expressed in mouse preimplantation embryos and decidual cells, with potential roles in embryonic development .

This functional diversity suggests that while sharing structural similarities, PAQR family members have evolved distinct signaling roles. Researchers should be cautious about assuming functional redundancy and should validate the specific roles of individual family members in their biological system of interest.

What are the optimal methods for studying PAQR3 protein-protein interactions?

Investigating PAQR3's interactions with binding partners requires careful consideration of its transmembrane nature and Golgi localization:

  • Co-immunoprecipitation: When using this approach:

    • Employ gentle detergents (0.5-1% NP-40 or 0.5% Triton X-100) to solubilize PAQR3 without disrupting protein-protein interactions

    • Include phosphatase inhibitors to preserve phosphorylation-dependent interactions

    • Consider crosslinking approaches for transient interactions

  • Proximity labeling: BioID or APEX2 fusion to PAQR3 can identify proximal proteins in the native cellular environment, particularly valuable for membrane proteins.

  • FRET/BRET assays: For studying dynamic interactions in living cells.

  • Reconstitution systems: In vitro reconstitution with purified components can validate direct interactions and determine stoichiometry.

When studying the ATG14L-VPS34 complex specifically, researchers should assess both the formation of the complex (protein-protein interactions) and its lipid kinase activity (PI3P production) .

How should researchers approach PAQR3 functional studies in different cell types?

Different cell types exhibit varying levels of basal autophagy and AMPK activity, which can influence PAQR3 function:

  • Baseline characterization:

    • Determine endogenous PAQR3 expression levels

    • Assess basal and induced autophagy flux (LC3-I to LC3-II conversion)

    • Evaluate glucose sensitivity and AMPK activation capacity

  • Cell type-specific considerations:

    • Neuronal cells: Focus on behavioral phenotypes and neurodegeneration markers

    • Hepatocytes: Examine metabolic functions and lipid handling

    • Immune cells: Investigate inflammatory responses and pathogen clearance

  • Stress induction protocols:

    • Glucose starvation: 0-2.5 mM glucose media for 2-12 hours

    • AMPK activation: AICAR (1-2 mM) or glucose deprivation

    • mTOR inhibition: Rapamycin (100 nM) or Torin1 (250 nM)

The cell type selection should align with the specific PAQR3 function being investigated. For autophagy studies, cells with robust autophagy responses (e.g., hepatocytes, fibroblasts) may be preferable, while neuronal cells are better suited for studying PAQR3's role in neurodegeneration .

What are the critical controls when studying PAQR3 phosphorylation by AMPK?

When investigating PAQR3 phosphorylation, several controls are essential:

  • Phosphorylation-deficient mutants:

    • T32A mutant: Cannot be phosphorylated by AMPK

    • Phosphomimetic T32D/E mutants: Mimic constitutive phosphorylation

  • AMPK manipulation controls:

    • AMPKα1/α2 siRNA or knockout: Genetic ablation of upstream kinase

    • Compound C treatment: Pharmacological AMPK inhibition

    • AMPK activator-resistant cells: Cells with AMPK mutation preventing activation

  • Specificity controls:

    • ATG14L knockdown: Verify ATG14L-dependency of phosphorylation

    • Other potential phosphorylation sites: Test additional S/T residues

  • Physiological relevance:

    • Glucose concentration gradient: Test phosphorylation across physiological glucose ranges

    • Kinetics: Time course of phosphorylation after glucose withdrawal

    • Reversibility: Recovery after glucose restoration

Proper controls ensure that observed phosphorylation events are specific, physiologically relevant, and mechanistically sound, enabling accurate interpretation of PAQR3's role in integrating AMPK signaling with autophagy initiation .

How might PAQR3 be targeted for therapeutic development in neurodegenerative diseases?

Given the behavioral abnormalities observed in PAQR3 knockout mice and the critical role of autophagy in neurodegeneration, PAQR3 represents a potential therapeutic target:

  • Target validation approaches:

    • Conditional PAQR3 knockout in specific brain regions

    • PAQR3 overexpression in neurodegenerative disease models

    • Assessment of PAQR3 levels in human neurodegenerative disease samples

  • Therapeutic strategies:

    • Small molecules targeting PAQR3-ATG14L interaction

    • Modulators of PAQR3 phosphorylation

    • Gene therapy approaches to restore PAQR3 function

  • Biomarker development:

    • Phospho-PAQR3 as a marker of autophagy competence

    • PAQR3 complex formation as an indicator of autophagy initiation capacity

PAQR3 knockout mice display motor and behavioral abnormalities reminiscent of neurodegenerative disorders, including limb clasping, reduced rotarod performance, abnormal gait, and decreased grip strength . These phenotypes suggest that PAQR3 modulators could potentially address similar symptoms in human neurodegenerative conditions.

What are the methodological challenges in studying membrane-associated proteins like PAQR3?

Membrane proteins present unique experimental challenges:

  • Solubilization issues:

    • Detergent selection critical for maintaining native conformation

    • Membrane microdomain association may affect extraction efficiency

    • Potential loss of interacting partners during solubilization

  • Structural analysis limitations:

    • Difficult to crystallize compared to soluble proteins

    • Cryo-EM often requires special preparation techniques

    • Native environment crucial for physiological conformation

  • Functional reconstitution:

    • Liposome reconstitution may not recapitulate Golgi membrane environment

    • Orientation in artificial membranes must be verified

    • Cofactors and lipid composition may affect function

  • Localization specificity:

    • Golgi-specific targeting mechanisms poorly understood

    • Trafficking dynamics during stress conditions unclear

    • Potential relocalization under various cellular conditions

Researchers should consider alternative approaches such as native membrane patches, nanodiscs, or cell-free expression systems with microsomes to overcome these challenges when studying PAQR3's structure and interactions .

What are the conflicting reports regarding PAQR3 function in different physiological contexts?

Several areas of PAQR3 biology contain apparent contradictions that require further investigation:

Resolving these contradictions will require careful experimental design, considering tissue context, stress conditions, and potential compensatory mechanisms among PAQR family members.

How does phosphorylation at different sites affect PAQR3's diverse functions?

  • Multiple kinase inputs:

    • Is PAQR3 targeted by kinases other than AMPK?

    • Do different phosphorylation events create a regulatory code?

    • How do different phosphorylation events interact functionally?

  • Phosphatase regulation:

    • Which phosphatases dephosphorylate PAQR3?

    • What is the kinetics of phosphorylation/dephosphorylation?

    • How is phosphatase activity regulated under different stress conditions?

  • Structural consequences:

    • How does T32 phosphorylation alter PAQR3 conformation?

    • Does phosphorylation create or disrupt specific binding interfaces?

    • Are there allosteric effects on distant protein regions?

Understanding the complete phosphorylation landscape of PAQR3 will be essential for developing targeted interventions and understanding its integration into cellular signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.