Recombinant Mouse Progestin and adipoQ receptor family member 6 (Paqr6)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

PAQR6 belongs to the membrane progesterone receptor (mPR) family, which mediates rapid, non-genomic P4 signaling. Key functional roles include:

Neurosteroid Signaling

PAQR6 binds neurosteroids (e.g., allopregnanolone, pregnenolone) and modulates neuronal apoptosis and synaptic plasticity. In human brain tissue, it is implicated in neurosteroid-induced signaling pathways .

Tumor Progression

In cancer models:

  • Prostate Cancer: PAQR6 upregulation correlates with advanced tumor stages (T3/T4) and lymph node metastasis (N1) .

  • Kidney Renal Clear Cell Carcinoma (KIRC): High PAQR6 expression associates with poor survival, angiogenesis, and immune evasion via pathways involving HIF1A, EGFR, and IL1A .

  • Therapeutic Target: Knockdown of PAQR6 inhibits proliferation, migration, and invasion in cancer cell lines (e.g., 769P KIRC cells) .

Cancer TypePAQR6 ExpressionClinical Correlation
Prostate (CRPC/NEPC)↑ (High)Advanced TNM staging, metastasis
Kidney (KIRC)↑ (High)Poor OS, angiogenesis, immune checkpoint resistance

Expression and Purification

PAQR6 is produced via recombinant systems (e.g., Pichia pastoris yeast or mammalian cells) to study its structure-function relationships. Key methodologies include:

  • Yeast Expression: Optimized for high-yield production of mPRs, enabling structural studies .

  • Mammalian Cell Systems: Used to validate steroid-binding specificity and G protein activation (e.g., G(s) signaling) .

Functional Validation

  • Steroid Binding: Recombinant PAQR6 exhibits high-affinity binding to P4 (Kd ~10–100 nM) and neurosteroids like DHEA and allopregnanolone .

  • G Protein Coupling: Activates G(s) pathways, leading to cAMP production and downstream signaling cascades .

Therapeutic Implications

PAQR6’s interaction with oncogenes such as EZH2 (a histone methyltransferase) highlights its role in epigenetic regulation and angiogenesis. Molecular docking studies suggest potential synergies with EZH2 inhibitors in cancer therapy .

Prostate Cancer Biomarker

ParameterLow PAQR6High PAQR6p-value
T stage (T3/T4 vs. T2)2.162 (1.495–3.144)1.651 (1.146–2.387)<0.001
N stage (N1 vs. N0)1.871 (1.132–3.152)1.941 (1.177–3.255)0.01

KIRC Pathway Enrichment

PAQR6 upregulation activates pathways critical for tumor growth:

PathwayEnrichment ScoreKey Genes
Angiogenesis0.72VEGFA, PDGFB
Pluripotent Stem Cell0.68OCT4, SOX2
Toll-like Receptor Signaling0.65TLR1, TLR2

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For convenient handling, we recommend briefly centrifuging the vial before opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Paqr6; Membrane progestin receptor delta; mPR delta; Membrane progesterone P4 receptor delta; Membrane progesterone receptor delta; Progesterone and adipoQ receptor family member 6; Progestin and adipoQ receptor family member 6; Progestin and adipoQ receptor family member VI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Paqr6
Target Protein Sequence
MLSLKMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTW YFLWRLLALGSPGFRADPYHLPLLVFLLPACLYPFASCCAHTFSSMSPRARHICYFLDYG ALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCYSRFPELEYPGFS KALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGRDALSSNHGYHLLCALLSGFLFAARL PERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLAVQEPTLGLGATVAT LSLAVIGNLFIIAAFTASLLRMPGPCPLLQGSPLEEGLQAKQQ
Uniprot No.

Target Background

Function
Plasma membrane progesterone (P4) receptor coupled to G proteins. It appears to function through a G(s) mediated pathway. Involved in neurosteroid inhibition of apoptosis. May play a role in regulating rapid P4 signaling in the nervous system. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Paqr6 and what are its known biological functions?

Paqr6, also known as membrane progesterone receptor delta (mPRδ), belongs to the progestin and adipoQ receptor family. It functions as a membrane-bound receptor involved in non-genomic progesterone signaling pathways. Research indicates that Paqr6 plays significant roles in cellular proliferation, migration, and invasion processes through interaction with multiple signaling pathways, including MEK/ERK signaling . Unlike classical nuclear progesterone receptors, Paqr6 mediates rapid responses to progesterone through membrane-initiated signaling cascades that affect cellular processes without direct gene transcription activation.

How does mouse Paqr6 differ from human PAQR6 in structure and function?

While both mouse Paqr6 and human PAQR6 share significant sequence homology and functional characteristics, species-specific differences exist in their regulatory elements and tissue distribution. Both are seven-transmembrane domain proteins that function as membrane progesterone receptors, but mouse models demonstrate some differences in expression patterns across tissues. When designing experiments using recombinant mouse Paqr6 to model human conditions, researchers should account for these species-specific variations. Comparative analysis of signaling outcomes should be performed to validate findings before extrapolating to human systems.

What expression patterns does Paqr6 exhibit across different mouse tissues?

Paqr6 shows differential expression across various mouse tissues, with notable presence in reproductive organs, kidney, and certain neuronal populations. Expression levels vary significantly between normal and pathological states, particularly in cancer tissues. Research approaches to characterize expression patterns typically include:

  • RT-qPCR analysis comparing relative expression across tissues

  • Immunohistochemistry for spatial localization

  • Western blotting for protein-level quantification

  • Single-cell RNA sequencing for cell-type specific expression profiling

The expression pattern analysis provides crucial baseline data for studying Paqr6 dysregulation in disease models.

What are the established methods for detecting Paqr6 expression in mouse tissue samples?

Multiple validated techniques can be employed to detect and quantify Paqr6 expression:

MethodApplicationSensitivityAdvantagesLimitations
RT-qPCRmRNA quantificationHighQuantitative, high throughputCannot detect protein localization
Western blottingProtein detectionModerateProtein size confirmationSemi-quantitative only
ImmunohistochemistryTissue localizationModerateSpatial informationAntibody specificity concerns
RNA in situ hybridizationmRNA localizationHighSpecific for transcript detectionTechnical complexity
Flow cytometryCell-specific expressionHighSingle-cell resolutionRequires cell dissociation

When designing experiments, researchers should consider combining multiple detection methods to validate findings, particularly given potential challenges with antibody specificity for membrane-bound receptors like Paqr6.

What is the role of Paqr6 in cancer progression and how can recombinant Paqr6 be used to investigate cancer mechanisms?

Research has demonstrated that Paqr6 expression is significantly upregulated in multiple cancer types, including prostate cancer, where elevated expression correlates with lower survival rates . Studies show that Paqr6 influences several hallmarks of cancer:

  • Cellular proliferation: Paqr6 depletion by siRNA in cancer cell lines (e.g., DU145) significantly suppresses cell proliferation (p<0.01) .

  • Migration capacity: Wound healing assays demonstrate reduced migratory potential following Paqr6 knockdown .

  • Signaling pathway activation: Paqr6 modulates MEK/ERK signaling cascades that promote cancer cell survival and proliferation .

Recombinant mouse Paqr6 can be used as a tool to investigate these mechanisms through:

  • Competition assays to block endogenous Paqr6 signaling

  • Structure-function studies using mutated recombinant proteins

  • Identification of binding partners through pull-down experiments

  • Development of targeted inhibitors based on structural insights

The methodological approach should include careful validation of recombinant protein activity before application in experimental systems.

How can copy number variations (CNVs) of Paqr6 be accurately assessed and what is their prognostic significance?

Copy number variations of Paqr6 serve as important prognostic biomarkers in several cancer types. In bladder cancer, Paqr6 CNVs correlate with disease-free survival and can help predict patient outcomes . Methodological approaches for CNV detection include:

  • Array-based comparative genomic hybridization (aCGH) - provides genome-wide assessment of copy number changes

  • Digital PCR - offers high precision quantification of absolute copy numbers

  • Next-generation sequencing approaches - enable comprehensive genomic profiling

For accurate CNV assessment, researchers should:

  • Use appropriate reference genes (e.g., TBP) as internal controls

  • Calculate ratio values to normalize data (ratio candidate/TBP)

  • Establish clearly defined cutoff values for clinical interpretation

  • Validate findings across independent patient cohorts

Studies have demonstrated that Paqr6 copy number gains were found in 60.0% of bladder cancer tumors, and CNVs of Paqr6 served as independent prognostic factors for disease-free survival in muscle-invasive bladder cancer patients . This highlights the potential utility of Paqr6 CNV assessment in cancer prognosis and treatment stratification.

What signaling pathways does Paqr6 interact with and how can these interactions be experimentally validated?

Paqr6 participates in multiple signaling cascades that influence cellular function and disease progression. Key pathways include:

  • MEK/ERK signaling - Paqr6 depletion reduces phosphorylation of MEK and ERK, indicating its role in activating this pathway

  • Immune microenvironment pathways - Including B cell receptor signaling and Toll-like receptor cascades

  • Angiogenesis pathways - Gene set enrichment analysis shows Paqr6 correlation with angiogenesis-related genes

  • Stem cell differentiation pathways - Paqr6 influences pluripotent stem cell differentiation processes

Experimental validation approaches include:

  • Phosphorylation analysis via western blotting following Paqr6 modulation

  • Co-immunoprecipitation to identify direct protein-protein interactions

  • Luciferase reporter assays to quantify pathway activation

  • RNA-seq and proteomics following Paqr6 knockdown/overexpression

  • CRISPR-Cas9 editing to create specific Paqr6 mutations affecting particular domains

Research has identified specific target genes regulated by Paqr6, including HIF1A, RAC1, EGFR, and IL1A, further supporting its role in multiple oncogenic pathways .

How does Paqr6 interact with other membrane progesterone receptors (mPRs) and what methodologies can distinguish their specific functions?

Paqr6 (mPRδ) is one of several membrane progesterone receptors in the PAQR family. Distinguishing its specific functions from other family members requires targeted experimental approaches:

MethodApplicationKey Considerations
Selective pharmacological toolsTarget-specific activation/inhibitionLimited availability of highly selective compounds
siRNA/shRNA knockdownSpecific gene silencingPotential off-target effects
CRISPR-Cas9 knockoutComplete gene eliminationCompensatory mechanisms may emerge
Overexpression studiesFunction in controlled systemsNon-physiological expression levels
Domain swappingIdentify functional regionsComplex protein engineering required

Researchers should employ multiple complementary approaches to delineate Paqr6-specific functions versus redundant activities shared with other family members. Care must be taken to validate the specificity of tools used, particularly antibodies which may cross-react with related family members.

What are the optimal conditions for expressing and purifying recombinant mouse Paqr6?

Recombinant mouse Paqr6 expression and purification requires careful optimization given its nature as a multi-pass membrane protein. Recommended approaches include:

  • Expression systems:

    • E. coli - suitable for full-length protein with appropriate solubilization tags

    • Mammalian expression systems - preserve post-translational modifications

    • Insect cell systems - balance between yield and proper folding

  • Purification strategies:

    • Affinity chromatography using His-tag or other fusion partners

    • Size exclusion chromatography for final polishing

    • Detergent screening to maintain protein stability and solubility

  • Quality control measures:

    • Western blotting to confirm identity and integrity

    • Circular dichroism to verify secondary structure

    • Functional assays to validate biological activity

Storage recommendations include maintaining purified protein in buffer containing 6% trehalose at pH 8.0, with aliquoting to avoid repeated freeze-thaw cycles . Long-term storage at -20°C/-80°C with 50% glycerol addition has been shown to preserve stability .

What are the critical considerations when designing knockdown/knockout experiments targeting Paqr6?

When designing genetic manipulation experiments targeting Paqr6, researchers should consider:

  • Knockdown approaches:

    • siRNA selection - target multiple regions to confirm specificity

    • Validation of knockdown efficiency - both mRNA (RT-qPCR) and protein (Western blot) levels

    • Appropriate negative controls - scrambled sequences with similar GC content

  • Knockout strategies:

    • CRISPR-Cas9 guide RNA design - minimize off-target effects

    • Validation of knockout - genomic sequencing, protein absence confirmation

    • Phenotypic rescue experiments - reintroduce wild-type or mutant Paqr6

  • Timeframe considerations:

    • Acute vs. chronic depletion effects - compensatory mechanisms may emerge

    • Cell type-specific responses - variations between different tissue contexts

Research has demonstrated that siRNA-mediated Paqr6 knockdown in cancer cell lines significantly reduces cell proliferation, migration, and invasion capabilities , highlighting the importance of thorough validation when interpreting phenotypic outcomes.

How can researchers accurately assess the functional activity of recombinant mouse Paqr6 in experimental systems?

Validating the functional activity of recombinant mouse Paqr6 is essential before applying it in experimental systems. Recommended methodological approaches include:

  • Receptor binding assays:

    • Radioligand binding using tritiated progesterone

    • Competition binding with known ligands

    • Surface plasmon resonance for binding kinetics

  • Signaling activation assessment:

    • Measurement of second messengers (cAMP, calcium flux)

    • Phosphorylation status of downstream effectors (MEK/ERK)

    • Reporter gene assays for pathway activation

  • Comparative analysis:

    • Side-by-side testing with endogenous Paqr6

    • Dose-response relationships

    • Specificity confirmed with antagonists

Researchers should establish clear functional readouts relevant to the biological processes being studied, such as cell proliferation, migration, or specific pathway activation markers.

How should researchers interpret discrepancies between Paqr6 mRNA and protein expression data?

Discrepancies between mRNA and protein levels are common in molecular biology research and can be particularly pronounced for membrane receptors like Paqr6. When faced with such inconsistencies, researchers should:

  • Consider post-transcriptional regulation:

    • microRNA-mediated suppression

    • mRNA stability differences

    • Translational efficiency variations

  • Evaluate technical factors:

    • Antibody specificity and sensitivity

    • Sample preparation differences

    • Detection method limitations

  • Implement validation strategies:

    • Use multiple antibodies targeting different epitopes

    • Employ overexpression and knockdown controls

    • Utilize multiple detection methods

  • Biological interpretation:

    • Temporal dynamics (mRNA changes may precede protein changes)

    • Tissue-specific regulatory mechanisms

    • Disease state influences on protein stability

Careful documentation of all technical parameters and biological variables is essential for proper interpretation of seemingly contradictory results.

What are the common pitfalls in Paqr6 research and how can they be avoided?

Research on membrane receptors like Paqr6 presents several challenges that researchers should proactively address:

  • Antibody specificity issues:

    • Validate with positive and negative controls

    • Confirm specificity with knockdown/knockout samples

    • Consider epitope-tagged constructs for detection

  • Membrane protein solubilization:

    • Optimize detergent selection for specific applications

    • Ensure complete solubilization without denaturing

    • Consider native membrane environments for functional studies

  • Expression system limitations:

    • E. coli may not provide proper folding and post-translational modifications

    • Mammalian systems may have endogenous expression interfering with results

    • Verify functionality of recombinant proteins

  • Genetic redundancy effects:

    • Compensatory upregulation of related family members

    • Overlapping functions masking phenotypes

    • Consider double/triple knockouts when appropriate

  • Data interpretation challenges:

    • Cell type-specific effects requiring careful experimental design

    • Concentration-dependent effects that may show biphasic responses

    • Contextual activation that depends on cellular state

By anticipating these challenges, researchers can design more robust experiments with appropriate controls and validation steps.

How can researchers integrate Paqr6 expression data with clinical outcomes in cancer research?

Integrating Paqr6 expression data with clinical outcomes requires systematic methodological approaches:

  • Study design considerations:

    • Prospective vs. retrospective analysis

    • Sample size calculations for adequate statistical power

    • Matched case-control design when possible

  • Expression analysis approaches:

    • RNA-seq for comprehensive transcriptomic profiling

    • Immunohistochemistry with tissue microarrays for large cohorts

    • Digital PCR for copy number variation assessment

  • Statistical methods:

    • Kaplan-Meier survival analysis with appropriate cutoff determination

    • Cox proportional hazards regression for multivariate analysis

    • Stratification by clinical variables (stage, grade, treatment)

  • Validation requirements:

    • Independent cohort confirmation

    • Multiple technical platforms

    • Meta-analysis of published datasets

Research has demonstrated that PAQR6 expression is significantly upregulated in prostate cancer tissues and correlates with lower survival rates (p=0.014) . Similarly, copy number variations of PAQR6 serve as independent prognostic factors for disease-free survival in muscle-invasive bladder cancer patients . These findings illustrate the potential of Paqr6 as a prognostic biomarker when properly analyzed in the context of clinical outcomes.

What are the promising therapeutic applications targeting Paqr6 in disease models?

Emerging research suggests several therapeutic strategies targeting Paqr6:

  • Direct inhibition approaches:

    • Small molecule antagonists of Paqr6

    • Blocking antibodies targeting extracellular domains

    • Peptide inhibitors of protein-protein interactions

  • Indirect targeting strategies:

    • Modulation of downstream signaling pathways

    • Combination with existing therapies (e.g., immune checkpoint inhibitors)

    • Synthetic lethality approaches

  • Expression modulation:

    • siRNA/shRNA delivery systems

    • CRISPR-based gene editing

    • Epigenetic modifiers affecting Paqr6 expression

Studies suggest that targeting Paqr6 may enhance response to immunotherapy in high-risk cancer patients, as high Paqr6 expression correlates with poor responses to immune checkpoint inhibitors . Additionally, the interaction between Paqr6 and EZH2 presents a novel therapeutic opportunity, with molecular docking studies identifying potential inhibitors that could disrupt this interaction .

How might multi-omics approaches advance our understanding of Paqr6 functions?

Integrative multi-omics approaches offer powerful tools to comprehensively understand Paqr6 functions:

  • Genomics approaches:

    • Whole-genome sequencing to identify genetic variants

    • ATAC-seq for chromatin accessibility analysis

    • ChIP-seq to identify transcription factor binding (e.g., EZH2 ChIP-seq analysis of Paqr6)

  • Transcriptomics methods:

    • RNA-seq following Paqr6 manipulation

    • Single-cell RNA-seq for cell-type specific responses

    • Spatial transcriptomics for tissue context

  • Proteomics strategies:

    • Interaction proteomics to identify binding partners

    • Phosphoproteomics to map signaling networks

    • Targeted proteomics for pathway validation

  • Metabolomics insights:

    • Global metabolite profiling following Paqr6 modulation

    • Flux analysis to determine metabolic pathway alterations

    • Integration with other omics data

  • Data integration frameworks:

    • Network analysis to identify functional modules

    • Systems biology modeling of dynamic responses

    • Machine learning approaches for predictive modeling

These integrated approaches can reveal unexpected functions and interactions of Paqr6 beyond current understanding, particularly in identifying novel signaling networks and therapeutic vulnerabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.