Recombinant Mouse Prokineticin receptor 2 (Prokr2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure

Prokr2 is a 384-amino-acid GPCR encoded by the Prokr2 gene (NCBI GeneID: 128674). It shares ~85% sequence identity with its paralog, Prokr1, and binds two ligands: Prokineticin 1 (Prok1) and Prokineticin 2 (Prok2). Key structural features include:

  • Seven transmembrane domains characteristic of GPCRs.

  • High expression in the suprachiasmatic nucleus (SCN), olfactory bulbs, arcuate nucleus, and dorsomedial hypothalamus .

  • Conserved binding regions for Prok2, critical for activating downstream signaling pathways .

Signaling Pathways

Prokr2 activation triggers multiple intracellular pathways:

PathwayMechanismBiological Role
IP3/Ca²⁺Gαq-mediated phospholipase C activationNeurogenesis, smooth muscle contraction
MAPKERK1/2 phosphorylationCell proliferation, circadian regulation
cAMPGαs-mediated adenylate cyclase inhibitionMetabolic regulation, mood modulation

Circadian Regulation

  • Prokr2 is essential for coordinating circadian rhythms. Prokr2 knockout mice exhibit:

    • Disrupted locomotor activity cycles (imprecise activity onsets, reduced consolidation) .

    • Attenuated nocturnal body temperature rhythms .

    • Loss of Prok2-mediated inhibition of daytime activity in nocturnal rodents .

Metabolic Regulation

  • Loss of Prokr2 predisposes mice to torpor (a hibernation-like state):

    • Spontaneous torpor bouts with marked decreases in body temperature (-5°C to -10°C) and metabolic rate (↓ O₂ consumption by 40%) .

    • Enhanced hypothermic response to food deprivation (24h fasting reduced body temperature by 12°C vs. 8°C in wild types) .

Reproductive Functions

  • Prokr2 is critical for GnRH neuron migration and reproductive axis development:

    • Prokr2⁻/⁻ mice show hypothalamic GnRH deficiency, olfactory bulb atrophy, and infertility .

    • Human PROKR2 mutations are linked to Kallmann Syndrome (KS), characterized by anosmia and hypogonadotropic hypogonadism .

Table 1: Phenotypic Effects of Prokr2 Knockout in Mice

PhenotypeObservationReference
Circadian disruptionFragmented activity cycles, delayed activity onset
Metabolic dysregulationSpontaneous torpor, ↓ body temperature
Reproductive defectsGnRH deficiency, gonadal atrophy

Table 2: Prokr2 Ligand Binding Affinities

LigandBinding Affinity (Kd)Assay
Prok21.2 nMRadioligand (¹²⁵I-MIT)
Prok13.8 nMCompetitive binding

Data inferred from displacement assays in wild-type vs. Prokr2⁻/⁻ mice .

Disease Implications

  • Kallmann Syndrome: Over 20 PROKR2 mutations (e.g., L173R, R164Q) are associated with KS in humans, often showing incomplete penetrance .

  • Metabolic Disorders: Dysregulated Prokr2 signaling may contribute to obesity or anorexia via hypothalamic energy-sensing pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Prokr2; Gpr73l1; Pkr2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGPQNRNTSFAPDLNPPQDHVSLNYSYGDYDLPLGEDEDVTKTQTFFAAKIVIGVALAGI MLVCGIGNFVFIAALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWAH GHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSIL IAVPSAYFTTETILVIVKNQEKIFCGQIWSVDQQLYYKSYFLFVFGLEFVGPVVTMTLCY ARISQELWFKAVPGFQTEQIRKRLRCRRKTVLLLMGILTAYVLCWAPFYGFTIVRDFFPT VVVKEKHYLTAFYVVECIAMSNSMINTICFVTVKNNTMKYFKKMLRLHWRPSHYGSKSSA DLDLKTSGVPATEEVDCIRLK
Uniprot No.

Target Background

Function
Prokineticin receptor 2 (Prokr2) serves as a receptor for prokineticin 2. It is exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation of Prokr2 triggers a cascade of cellular responses, including calcium mobilization, phosphoinositide turnover stimulation, and activation of p44/p42 mitogen-activated protein kinase.
Gene References Into Functions
  1. The sexually dimorphic expression pattern of Prokr2 suggests distinct roles in reproductive function and potentially other physiological systems. PMID: 28616754
  2. This study provides the first experimental evidence for a molecular interaction between anosmin 1 and PKR2. A truncated anosmin 1 protein, encompassing the first three domains, interacts with the second extracellular loop of PKR2, a region involved in PK2 binding. PMID: 27184500
  3. Our findings indicate that prokineticins and their receptors, including PROK2, PKR1, and PKR2, contribute to altered sensitivity in diabetic neuropathy. Inhibition of this pathway blocked both allodynia and inflammatory events associated with the disease. PMID: 26730729
  4. Studies reveal that PK2 signaling is essential for maintaining normal female estrous cycles. PMID: 24633064
  5. We aimed to clarify the role of PROKR2 in hypothalamopituitary development by analyzing Prokr2(-/-) mice. PMID: 23386640
  6. Prokr2 is specifically expressed in the XY gonads during sex determination and fetal sexual differentiation. Knockout mice exhibit a variable degree of compromised vasculature in the fetal testes PMID: 22223120
  7. The functional characteristics of coronary endothelial cells are influenced by the expression levels of PKR1 and PKR2 and the distinct signaling pathways utilized by these receptors. PMID: 20023120
  8. Prokineticin 2 is expressed in neurons of the mouse suprachiasmatic nucleus PMID: 19784373
  9. Phenotypic analysis revealed that Pkr2(-/-) mice, but not Pkr1(-/-) mice, exhibited hypoplasia of the olfactory bulb. PMID: 16537498
  10. Prokr2 plays a crucial role in coordinating circadian behavior and physiology by the suprachiasmatic nucleus, particularly in defining the onset and maintenance of circadian night PMID: 17202262
  11. PKR2 expression was maintained over 10.5dpc with both trophoblastic and endothelial cell localizations in mice. PMID: 17531315
  12. Prokr2 plays a significant role in olfactory bulb neurogenesis. PMID: 18052978
  13. Prokineticin 2 polypeptide (Prokr2) signaling contributes to hypothalamic regulation of energy balance. Loss of this pathway leads to physiological and behavioral responses typically observed in mice experiencing negative energy balance. PMID: 18417646
  14. PKR2 signaling in cardiomyocytes promotes eccentric hypertrophy through an autocrine mechanism and impairs endothelial integrity through a paracrine mechanism without inducing angiogenesis. PMID: 18806277
  15. All mutated PROKR2 variants, except one (M323I), exhibited reduced signaling activities. PMID: 18826963
  16. Our research elucidates the identity of prokineticin receptor 2-expressing cells within the subventricular zone/rostral migratory stream/olfactory bulb pathway in adult mice. PMID: 19003791
  17. Our data demonstrate that the inflammation-induced up-regulation of PK2 was significantly less in pkr1 null mice compared to WT and pkr2 null mice. This finding highlights the role of PKR1 in regulating PK2 levels during inflammation. PMID: 19667192

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in several regions of the brain, including paraventricular hypothalamic nucleus, dorsal medial hypothalamic nucleus, paratenial thalamic nuclei, paracentral thalamic nucleus, lateral habenular nucleus, lateral septal nucleus, lateral globus pall

Q&A

What is Prokineticin Receptor 2 (Prokr2) and what role does it play in mouse physiology?

Prokineticin Receptor 2 (Prokr2) is a G-protein coupled receptor that binds to Prokineticin 2 (Prok2) and serves as a critical component in the regulation of circadian rhythm and energy homeostasis. This receptor is widely expressed in both the suprachiasmatic nucleus (SCN) and its hypothalamic targets, where it functions as part of a signaling pathway implicated in the circadian regulation of behavior and physiology . The Prokr2 signaling pathway appears to be essential for maintaining proper circadian coordination of physiological processes including thermoregulation and locomotor activity . Additionally, research suggests that Prokr2 signaling plays a significant role in the hypothalamic regulation of energy balance, as disruption of this pathway results in physiological responses typically associated with negative energy balance states .

How does Prokineticin 2 (Prok2) function in relation to Prokr2?

Prokineticin 2 (Prok2) is the ligand that binds to Prokr2 to activate its signaling cascade. This protein may function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm . Studies suggest that Prok2 may also function locally within the SCN to synchronize output signals . In addition to its role in circadian regulation, Prok2 has been shown to potently contract gastrointestinal (GI) smooth muscle, indicating a broader physiological role beyond the central nervous system . Prok2 belongs to the AVIT (prokineticin) family of proteins, which are characterized by their conserved N-terminal sequences and distinctive patterns of cysteine residues that form disulfide bridges critical for their biological activity .

What phenotypes are observed in Prokr2 knockout mice?

Mice lacking functional Prokr2 signaling (Prokr2 m/m) exhibit several distinct phenotypes that highlight the importance of this receptor in physiological regulation:

These phenotypes collectively suggest that Prokr2 signaling is critical for both circadian rhythm regulation and energy homeostasis.

What are the most effective techniques for studying Prokr2 function in vivo?

Studying Prokr2 function in vivo requires a combination of genetic, physiological, and behavioral approaches. Based on current research methodologies, the following techniques have proven most effective:

  • Genetic Models: Utilizing Prokr2 knockout mice (Prokr2 m/m) alongside heterozygous (Prokr2 +/m) and wild-type (Prokr2 +/+) littermates as controls allows for direct assessment of Prokr2's physiological roles . These models should be carefully genotyped and age-matched (typically 4-8 months old) for experimental consistency .

  • Radiotelemetry: Implantable telemetry devices provide continuous monitoring of body temperature and activity patterns without disturbing the animals . This involves surgical implantation of transmitters into the peritoneal cavity under appropriate anesthesia (ketamine/medetomidine mixture) with post-surgical analgesic treatment (carprofen) . Data can be collected at frequent intervals (e.g., 10 seconds every 2 minutes) over extended periods (4-7 weeks) to capture both regular patterns and spontaneous events like torpor .

  • Metabolic Phenotyping: Comprehensive Laboratory Animal Monitoring Systems (CLAMS) enable measurement of oxygen consumption, carbon dioxide production, respiratory quotient, physical activity, and feeding behavior . These parameters should be monitored under both standard conditions and during experimental manipulations like food deprivation .

  • Photocycle Manipulation: Assessing physiological parameters under different lighting conditions (e.g., 12:12 light-dark cycle vs. continuous darkness) helps determine the circadian components of Prokr2-mediated effects .

  • Food Deprivation Challenges: Controlled food deprivation protocols (16-24 hours) with continuous monitoring of physiological parameters can reveal the role of Prokr2 in energy homeostasis regulation .

Combining these approaches provides a comprehensive view of Prokr2 function across multiple physiological systems and behavioral states.

How should researchers design experiments to investigate the interaction between Prokr2 signaling and circadian rhythms?

Designing experiments to investigate the interaction between Prokr2 signaling and circadian rhythms requires careful consideration of several factors:

  • Animal Model Selection: Compare Prokr2 knockout mice (Prokr2 m/m) with heterozygous (Prokr2 +/m) and wild-type (Prokr2 +/+) littermates to ensure genetic background consistency . Include both male and female mice to account for potential sex differences in circadian regulation .

  • Acclimation Period: Allow at least two weeks of habituation to the experimental environment before beginning data collection to minimize stress effects on circadian parameters .

  • Lighting Protocol Design:

    • Begin with standard 12:12 light-dark cycle (LD) conditions for baseline measurements

    • Transition to continuous darkness (DD) to assess free-running circadian rhythms

    • Consider additional protocols such as light pulses during dark periods or jet-lag simulations to assess circadian entrainment capabilities

  • Comprehensive Parameter Monitoring:

    • Core body temperature and activity through radiotelemetry

    • Metabolic parameters (VO₂, VCO₂, RQ) using metabolic cages

    • Feeding patterns (timing, frequency, and amount)

    • Sleep-wake cycles if possible

  • Data Collection Duration: Monitor parameters for extended periods (minimum 3-4 weeks) to establish reliable circadian patterns and capture sporadically occurring phenomena like torpor bouts .

  • Analytical Approaches:

    • Period and phase analysis of rhythmic parameters

    • Comparisons between genotypes across different circadian conditions

    • Assessment of rhythmic parameter coordination (e.g., temperature-activity relationships)

    • Statistical analysis accounting for both genotype and time effects

This experimental framework enables comprehensive assessment of how Prokr2 signaling contributes to circadian rhythm regulation and coordination.

What methodological considerations are important when measuring torpor in Prokr2 knockout mice?

Accurately measuring and characterizing torpor in Prokr2 knockout mice requires attention to several methodological considerations:

  • Continuous Monitoring: Torpor bouts occur spontaneously and sporadically in Prokr2 m/m mice, necessitating continuous monitoring over extended periods (weeks rather than days) to capture these events . Radiotelemetry provides the most reliable method for this purpose.

  • Parameter Definition: Establish clear criteria for identifying torpor states. In research with Prokr2 knockout mice, torpor has been characterized by:

    • Substantial decreases in body temperature

    • Markedly reduced locomotor activity

    • VO₂ dropping below 200ml/hr/kg^0.75

    • RQ decreasing to approximately 0.7

  • Timing Considerations: Pay particular attention to monitoring during the late dark phase and early light phase, as this is when torpor bouts typically begin in Prokr2 knockout mice .

  • Environmental Controls: Maintain consistent ambient temperature and humidity, as environmental fluctuations can influence torpor incidence and depth .

  • Nutritional Status: Record and control food intake, as torpor is associated with energy conservation during negative energy balance . Consider both ad libitum feeding and controlled food deprivation protocols.

  • Data Analysis Approach: For statistical comparisons of general metabolic parameters between genotypes, exclude data from 24-hour periods in which torpor bouts occurred to avoid skewing results . Analyze torpor episodes separately with metrics such as:

    • Frequency of occurrence

    • Duration of bouts

    • Depth of temperature decrease

    • Metabolic suppression magnitude

  • Technical Limitations: Be aware that extremely low metabolic rates during deep torpor may approach the detection limits of metabolic measurement equipment, potentially creating artifacts in calculated parameters like RQ .

These methodological considerations ensure accurate characterization of the unique torpor phenotype in Prokr2 knockout mice and facilitate meaningful comparisons between experimental groups.

How should researchers interpret changes in respiratory quotient (RQ) in Prokr2 knockout mice?

Interpreting changes in respiratory quotient (RQ) in Prokr2 knockout mice requires careful consideration of both physiological principles and technical limitations:

  • Baseline Understanding: RQ is the ratio of carbon dioxide produced to oxygen consumed (VCO₂/VO₂) and indicates the primary metabolic fuel being utilized. An RQ of approximately 1.0 suggests predominant carbohydrate metabolism, while an RQ of approximately 0.7 indicates predominant fat metabolism .

  • Circadian Variation: Wild-type and heterozygous control mice typically exhibit circadian variations in RQ, with values around 0.95 during the dark (active) phase and 0.81-0.87 during the light (rest) phase . These fluctuations reflect normal diurnal changes in substrate utilization, with greater carbohydrate use during active periods.

  • Torpor-Associated Changes: During torpor bouts in Prokr2 m/m mice, RQ decreases to approximately 0.7, indicating a shift toward primarily fat metabolism . This metabolic switch is consistent with energy conservation strategies during torpor, as fat metabolism yields more energy per gram than carbohydrate metabolism.

  • Technical Considerations: RQ values below 0.7 sometimes observed during torpor bouts should be interpreted cautiously, as they likely represent measurement artifacts. When VO₂ and VCO₂ are extremely low during deep torpor, the ratio becomes much more sensitive to the variance and limited resolution of gas analyzers .

  • Non-Torpor Comparisons: Interestingly, during non-torpor periods, RQ values do not significantly differ between Prokr2 m/m mice and littermate controls despite differences in other metabolic parameters . This suggests that baseline substrate preference is not altered by Prokr2 deficiency under normal conditions.

  • Experimental Context: Interpret RQ data in the context of feeding status, activity levels, and time of day, as these factors can influence substrate utilization independently of direct Prokr2 signaling effects .

The table below summarizes RQ values observed in male and female mice of different genotypes:

SexGenotypeDark Phase RQLight Phase RQStatistical Significance
Male+/+ or +/m0.95±0.020.81±0.03Genotype effect: F=1.10, P=0.32
Malem/m0.93±0.030.86±0.03Gender effect: F=2.11, P=0.17
Female+/+ or +/m0.91±0.020.87±0.05Interaction: F=0.41, P=0.54 (dark)
Femalem/m0.84±0.030.79±0.02Interaction: F=3.28, P=0.10 (light)

These data demonstrate that careful analysis of RQ provides valuable insights into the metabolic consequences of Prokr2 deficiency, particularly during torpor states .

What statistical approaches are most appropriate for analyzing metabolic data from Prokr2 knockout studies?

Analyzing metabolic data from Prokr2 knockout studies requires statistical approaches that account for multiple factors including genotype, sex, time of day, and the sporadic nature of torpor events:

  • Factorial ANOVA: Two-way or three-way ANOVA is appropriate for analyzing the effects of multiple factors (genotype, sex, photoperiod) and their interactions on continuous variables such as VO₂, VCO₂, RQ, food intake, and activity levels . This approach allows for assessment of:

    • Main effect of Prokr2 genotype (+/+, +/m, m/m)

    • Main effect of sex (male vs. female)

    • Main effect of photoperiod (light vs. dark phase)

    • Interaction effects between these factors

  • Data Exclusion Criteria: Establish clear criteria for handling data from torpor episodes. In published research, 24-hour periods containing torpor bouts were excluded from general metabolic comparisons to prevent these episodic events from skewing the analysis of baseline differences between genotypes .

  • Repeated Measures Analysis: For longitudinal data collected over multiple days, repeated measures ANOVA or mixed-effects models should be employed to account for within-subject correlations and time-dependent changes.

  • Appropriate Data Normalization: Metabolic parameters should be normalized to metabolic body size (body weight^0.75) rather than raw body weight to account for the non-linear relationship between body size and metabolic rate . This is particularly important when comparing mice with different body weights.

  • Non-Parametric Alternatives: For data that violate assumptions of normality or homogeneity of variance, non-parametric tests such as Kruskal-Wallis (for genotype effects) or Mann-Whitney U (for pairwise comparisons) may be more appropriate.

  • Torpor Episode Analysis: For analyzing characteristics of torpor episodes specifically:

    • Frequency analysis (chi-square test for incidence)

    • Duration analysis (comparing mean bout length)

    • Depth analysis (minimum temperature or VO₂ reached)

  • Presentation of Results: Results should be presented with appropriate measures of central tendency and dispersion (mean ± SEM), F-statistics with degrees of freedom, and exact p-values as demonstrated in the reference study .

The table below exemplifies appropriate statistical reporting for metabolic parameters:

ParameterPhaseMale +/+ or +/mMale m/mFemale +/+ or +/mFemale m/mGenotype EffectGender EffectInteraction
VO₂ (ml/kg^0.75/h)dark1315±711107±411556±251994±18F=7.82, P<0.05F=0.91, P=0.36F=3.58, P=0.09
VO₂ (ml/kg^0.75/h)light1319±581143±421310±1471064±21F=6.86, P<0.05F=0.30, P=0.60F=0.19, P=0.66
VCO₂ (ml/kg^0.75/h)dark1255±781030±321412±220831±42F=12.3, P<0.005F=0.03, P=0.86F=2.40, P=0.15
VCO₂ (ml/kg^0.75/h)light1068±75979±441176±26841±20F=10.4, P<0.01F=0.05, P=0.82F=3.49, P=0.09

This comprehensive statistical approach ensures robust analysis and interpretation of the complex metabolic phenotypes associated with Prokr2 deficiency .

How can researchers distinguish between direct effects of Prokr2 signaling and secondary metabolic adaptations?

Distinguishing between direct effects of Prokr2 signaling and secondary metabolic adaptations presents a significant challenge in research interpretation. Researchers should consider the following methodological approaches:

  • Temporal Analysis: Examine the time course of physiological changes following genetic or pharmacological manipulation of Prokr2 signaling. Primary effects typically occur rapidly, while secondary adaptations develop over longer periods . Monitoring parameters like body temperature, activity, and metabolic rate immediately after acute manipulation of Prokr2 signaling can help identify direct effects.

  • Conditional Knockout Models: Utilize tissue-specific or inducible Prokr2 knockout models to isolate the effects of Prokr2 deficiency to specific tissues or time points. This approach helps distinguish between direct effects in Prokr2-expressing tissues and secondary adaptations in downstream systems.

  • Pair-Feeding Studies: Implement pair-feeding protocols where control mice receive exactly the same amount of food consumed by Prokr2 m/m mice . This controls for the effects of reduced food intake observed in Prokr2 knockout mice and helps separate direct Prokr2 signaling effects from those secondary to altered feeding behavior.

  • Pathway Analysis: Examine molecular markers in the Prokr2 signaling pathway and downstream effectors. Direct effects should show immediate changes in signaling molecules directly linked to Prokr2 activation, while secondary adaptations may involve compensatory changes in parallel pathways.

  • Pharmacological Manipulation: Use selective Prokr2 agonists or antagonists with different administration schedules (acute versus chronic) to distinguish between immediate signaling effects and adaptive responses that develop over time.

  • Correlation Analysis: Analyze correlations between different physiological parameters in individual animals. Parameters directly regulated by Prokr2 should show stronger correlations with Prokr2 expression or activation levels than those affected through secondary mechanisms .

  • Challenge Tests: Subject animals to physiological challenges such as food deprivation or cold exposure. The research showed that food deprivation produced greater decreases in body temperature, oxygen consumption, and carbon dioxide production in Prokr2 m/m mice than controls, suggesting a direct role of Prokr2 in energy homeostasis regulation rather than just a secondary adaptation .

This multi-faceted approach allows researchers to develop a more nuanced understanding of how Prokr2 signaling directly influences physiological processes versus secondary adaptations that emerge in response to altered energy balance or circadian function.

How does Prokr2 signaling interact with other circadian regulatory pathways?

Prokr2 signaling interacts with multiple circadian regulatory pathways, forming part of a complex network that coordinates physiological and behavioral rhythms:

  • Suprachiasmatic Nucleus Integration: Prokr2 and its ligand Prok2 are widely expressed in the suprachiasmatic nucleus (SCN), which serves as the master circadian pacemaker . This expression pattern suggests that Prokr2 signaling functions both as an output pathway from the SCN to target tissues and as a local synchronizing mechanism within the SCN itself .

  • Dual Signaling Roles: Research indicates that Prokr2 may function as an output molecule from the SCN that transmits behavioral circadian rhythm to downstream targets, and may also function locally within the SCN to synchronize output signals . This dual role positions Prokr2 signaling as both a mediator and modulator of circadian information.

  • Circadian Rhythm Disruption: The disruption of circadian coordination of locomotor activity and thermoregulation in Prokr2 knockout mice demonstrates that Prokr2 signaling is necessary for proper integration of multiple circadian outputs . This suggests interaction with pathways controlling both activity and temperature regulation.

  • Persistence in Free-Running Conditions: The fact that torpor bouts in Prokr2 knockout mice persist when animals are exposed to continuous darkness indicates that the interaction between Prokr2 signaling and circadian mechanisms is maintained even in the absence of external light cues . This suggests involvement with the endogenous circadian timing system rather than just light-responsive pathways.

  • Temporal Gating of Torpor: The observation that spontaneous torpor bouts in Prokr2 knockout mice generally began towards the end of the dark phase or in the early light phase suggests that Prokr2 signaling normally inhibits torpor during specific circadian phases . This indicates interaction with phase-specific circadian regulatory mechanisms.

  • Energy Sensing Integration: The enhanced sensitivity of Prokr2 knockout mice to food deprivation suggests that Prokr2 signaling integrates circadian timing with energy status information . This points to potential interactions with metabolic sensing pathways such as AMPK, mTOR, or sirtuins that connect energy status to circadian processes.

Understanding these complex interactions provides insight into how Prokr2 contributes to the coordination of multiple physiological systems with circadian timing, and how disruption of this signaling can lead to desynchronization of various rhythmic processes.

What potential therapeutic applications might arise from understanding Prokr2 signaling in relation to energy homeostasis?

Understanding Prokr2 signaling in relation to energy homeostasis could lead to several potential therapeutic applications:

  • Metabolic Disorders Treatment: The observation that Prokr2 knockout mice have significantly lower oxygen consumption, carbon dioxide production, and food intake suggests that modulating Prokr2 signaling could potentially influence metabolic rate and appetite . This could lead to novel therapeutic approaches for conditions like obesity and metabolic syndrome, where energy balance is dysregulated.

  • Torpor Induction for Medical Applications: The spontaneous torpor observed in Prokr2-deficient mice reveals a potential pathway for inducing controlled hypometabolic states in humans . Such states could be beneficial in emergency medicine (reducing tissue damage during limited oxygen supply), surgical procedures (organ preservation), or space medicine (metabolic suppression during long-duration spaceflight).

  • Circadian Rhythm Disorders: Given Prokr2's role in coordinating circadian rhythms of locomotor activity and thermoregulation, targeted Prokr2 modulators could help restore proper circadian timing in disorders like delayed sleep phase syndrome, shift work disorder, or jet lag . Properly timed administration of Prokr2 agonists or antagonists might help realign disrupted circadian rhythms.

  • Fasting-Mimetic Therapies: The enhanced response to food deprivation in Prokr2 knockout mice suggests that temporary inhibition of Prokr2 signaling might amplify the beneficial effects of fasting without requiring complete food restriction . This could lead to fasting-mimetic therapies for conditions where periodic metabolic reprogramming is beneficial, such as certain inflammatory or neurodegenerative diseases.

  • Energy Conservation in Critical Illness: The ability of Prokr2-deficient mice to reduce energy expenditure more substantially during food deprivation suggests potential applications in critical care medicine . Temporary Prokr2 inhibition during critical illness might help patients conserve energy when nutrient intake is limited or metabolic demands are high.

  • Hypothalamic Dysfunction Treatment: Since Prokr2 signaling plays a role in hypothalamic regulation of energy balance, therapies targeting this pathway could potentially address conditions involving hypothalamic dysfunction, such as hypothalamic obesity or anorexia .

  • Biomarkers for Metabolic Dysfunction: Understanding the normal patterns of Prokr2 expression and signaling could lead to the development of biomarkers that predict susceptibility to metabolic dysregulation or indicate the effectiveness of therapeutic interventions targeting energy homeostasis.

These potential applications highlight the importance of continuing research into the fundamental mechanisms by which Prokr2 signaling influences energy homeostasis and circadian physiology.

How might environmental factors influence Prokr2 expression and function?

Environmental factors likely exert significant influence on Prokr2 expression and function, though specific research on this topic is limited in the provided search results. Based on the known roles of Prokr2 in circadian rhythm regulation and energy homeostasis, several environmental factors may modulate its expression and function:

  • Light Exposure: Given Prokr2's expression in the suprachiasmatic nucleus (SCN) and its role in circadian rhythm regulation , light exposure patterns likely influence its expression and signaling. Changes in photoperiod (seasonal variations in day length) may alter Prokr2 expression patterns to coordinate seasonal adaptations in physiology and behavior.

  • Nutritional Status: The enhanced sensitivity of Prokr2 knockout mice to food deprivation suggests that Prokr2 signaling is responsive to nutritional status . Fasting, caloric restriction, or specific dietary compositions may modulate Prokr2 expression to coordinate appropriate physiological responses to changing nutritional environments.

  • Ambient Temperature: Since Prokr2 signaling influences thermoregulation, and Prokr2 knockout mice show altered temperature regulation during torpor , ambient temperature likely affects Prokr2 expression and function. Cold exposure might enhance Prokr2 signaling to prevent inappropriate torpor entry, while warm environments might reduce this signaling.

  • Stress Exposure: Stress alters many hypothalamic signaling pathways, and given Prokr2's expression in hypothalamic regions , various stressors (physical, psychological, or metabolic) may influence its expression and function to coordinate appropriate physiological responses.

  • Seasonal Factors: Beyond photoperiod, other seasonal factors such as food availability may influence Prokr2 signaling. The torpor phenotype observed in Prokr2 knockout mice resembles natural torpor used by some mammals during seasonal food scarcity , suggesting Prokr2 may be involved in seasonal physiological adaptations.

  • Circadian Disruption: Disruption of normal circadian rhythms through shift work, jet lag, or irregular sleep-wake patterns may alter Prokr2 expression and function, potentially contributing to the metabolic consequences associated with circadian misalignment.

  • Age-Related Changes: Developmental stage and aging may influence Prokr2 expression and function, as many hypothalamic signaling pathways show age-dependent changes in activity. The research controlled for age effects by using mice between approximately 4 and 8 months old , suggesting recognition of potential age-related variations.

Research examining how these environmental factors influence Prokr2 expression and function would provide valuable insights into the adaptability of energy homeostasis and circadian systems to changing environmental conditions, potentially revealing new approaches for treating disorders related to these systems.

What are the most promising areas for future Prokr2 research?

The current understanding of Prokr2 signaling reveals several promising areas for future research that could significantly advance both basic science and potential therapeutic applications:

  • Tissue-Specific Functions: Developing and characterizing conditional Prokr2 knockout models targeting specific tissues (hypothalamus, liver, adipose tissue, muscle) would help delineate the relative contributions of central versus peripheral Prokr2 signaling to energy homeostasis and circadian coordination . This approach would overcome the limitations of global knockout models where compensatory mechanisms may mask tissue-specific effects.

  • Signaling Pathway Characterization: Detailed molecular characterization of the downstream effectors of Prokr2 activation would enhance our understanding of how this receptor influences cellular metabolism and circadian function . This should include identification of transcription factors, second messengers, and target genes regulated by Prokr2 signaling.

  • Pharmacological Modulators: Development of selective Prokr2 agonists and antagonists would enable more precise temporal control over Prokr2 signaling than genetic approaches allow . Such compounds would facilitate both basic research and exploration of potential therapeutic applications, particularly for conditions involving dysregulated energy metabolism or circadian rhythms.

  • Interaction with Metabolic Hormones: Investigating the interplay between Prokr2 signaling and established metabolic regulators such as leptin, ghrelin, insulin, and glucagon would provide insights into how Prokr2 is integrated into the broader neuroendocrine control of energy balance . This could reveal synergistic or antagonistic relationships that influence whole-body metabolism.

  • Human Genetic Studies: Examining associations between PROKR2 genetic variants and phenotypes related to energy metabolism, circadian rhythms, and sleep in human populations could translate findings from mouse models to human physiology and pathology . This approach might identify individuals who could particularly benefit from therapies targeting this pathway.

  • Therapeutic Induction of Torpor-Like States: Building on the observation that Prokr2 deficiency predisposes mice to torpor , research could explore whether controlled manipulation of Prokr2 signaling could safely induce torpor-like states in non-hibernating mammals, including humans. This could have applications in emergency medicine, surgery, and space travel.

  • Circadian Medicine Applications: Investigating whether timed administration of Prokr2 modulators could help realign disrupted circadian rhythms would have direct relevance to conditions like shift work disorder, jet lag, and delayed sleep phase syndrome .

These research directions would significantly expand our understanding of how Prokr2 signaling influences fundamental physiological processes and could lead to novel therapeutic approaches for various metabolic and circadian disorders.

What technical advances would facilitate more comprehensive study of Prokr2 function?

Several technical advances would substantially enhance our ability to study Prokr2 function comprehensively:

  • Improved Genetic Models: Development of more sophisticated genetic tools would advance Prokr2 research:

    • Inducible knockout systems allowing temporal control of Prokr2 expression

    • Cre-lox tissue-specific knockout models targeting discrete brain regions or peripheral tissues

    • CRISPR/Cas9-mediated knock-in models with fluorescent tags for tracking Prokr2 expression and localization

    • Humanized mouse models expressing human PROKR2 to better translate findings to human physiology

  • Advanced Imaging Techniques: Implementation of cutting-edge imaging would provide dynamic insights into Prokr2 function:

    • In vivo calcium imaging to monitor real-time activity of Prokr2-expressing neurons

    • PET imaging with Prokr2-specific radiotracers to map receptor distribution and occupancy

    • Functional MRI studies correlating Prokr2 activity with brain-wide network dynamics

    • Multiplexed in situ hybridization to simultaneously visualize Prokr2 expression alongside interacting signaling components

  • Biosensors and Optogenetics: Development of molecular tools for precise manipulation and monitoring:

    • FRET-based biosensors for real-time monitoring of Prokr2 activation and downstream signaling

    • Optogenetic approaches for temporally precise activation or inhibition of Prokr2-expressing cells

    • Chemogenetic tools (DREADDs) for reversible manipulation of Prokr2 neurons over longer timeframes

  • Improved Metabolic Phenotyping: Enhanced techniques for comprehensive metabolic assessment:

    • Continuous glucose monitoring in freely moving mice to correlate glycemic control with Prokr2 signaling

    • Automated home cage monitoring systems combining metabolic measurements with detailed behavioral analysis

    • Higher resolution indirect calorimetry capable of detecting subtle changes in energy expenditure during torpor transitions

    • Stable isotope techniques to track specific metabolic pathways influenced by Prokr2 signaling

  • Pharmacological Tools: Development of compounds for manipulating Prokr2 signaling:

    • Highly selective Prokr2 agonists and antagonists with optimized pharmacokinetics

    • Allosteric modulators targeting specific downstream signaling pathways

    • PROTACs (proteolysis targeting chimeras) for selective degradation of Prokr2 protein

    • Blood-brain barrier penetrant compounds for targeting central Prokr2 receptors

  • Multi-omics Approaches: Implementation of comprehensive molecular profiling:

    • Single-cell transcriptomics of Prokr2-expressing cells under different physiological conditions

    • Proteomics and phosphoproteomics to map signaling cascades downstream of Prokr2 activation

    • Metabolomics to identify metabolic signatures associated with altered Prokr2 signaling

    • Integration of multi-omics data through advanced computational modeling

These technical advances would overcome current limitations in studying Prokr2 function and provide unprecedented insights into how this signaling pathway coordinates circadian rhythms and energy homeostasis.

How might studying Prokr2 inform our understanding of evolutionary adaptations in energy conservation?

Studying Prokr2 provides a unique window into evolutionary adaptations for energy conservation, particularly through the lens of torpor regulation:

  • Ancient Energy Conservation Mechanisms: The spontaneous torpor observed in Prokr2 knockout mice suggests that Prokr2 signaling may normally suppress ancient energy conservation mechanisms that evolved early in mammalian history . By studying how Prokr2 modulates these mechanisms, researchers can gain insights into evolutionarily conserved pathways for energy management that predate the divergence of hibernating and non-hibernating species.

  • Comparative Physiology Opportunities: The Prokr2 knockout phenotype creates an opportunity for comparative studies between these genetically modified mice and naturally hibernating species . Such comparisons could reveal whether similar molecular pathways are involved in natural torpor and hibernation, potentially identifying conserved genetic networks that evolved for energy conservation.

  • Adaptive Significance of Circadian-Metabolic Integration: The role of Prokr2 in both circadian rhythm regulation and energy homeostasis highlights the evolutionary importance of integrating these systems . This integration likely evolved to optimize energy utilization according to predictable environmental cycles of food availability and temperature, representing an adaptive advantage in fluctuating environments.

  • Evolutionary Trade-offs: The fact that loss of Prokr2 signaling predisposes mice to torpor suggests that maintaining active Prokr2 signaling carries some evolutionary advantage despite its energy cost . This could reflect a trade-off between energy conservation and other fitness benefits such as predator avoidance, reproductive opportunities, or cognitive function that would be compromised during torpor states.

  • Seasonal Adaptation Mechanisms: The torpor phenotype in Prokr2 knockout mice resembles natural daily torpor used by small mammals during seasonal food scarcity . Understanding how Prokr2 normally prevents inappropriate torpor entry could reveal mechanisms by which seasonal mammals appropriately time their energy conservation strategies with environmental conditions.

  • Metabolic Flexibility Evolution: The enhanced metabolic response to food deprivation in Prokr2 knockout mice suggests that Prokr2 signaling may normally limit metabolic flexibility . This could reflect evolutionary adaptation to stable food environments where extreme energy conservation is disadvantageous, contrasting with species adapted to variable food availability.

  • Hypothalamic Evolution: The expression of Prokr2 in the hypothalamus, a brain region highly conserved across vertebrates, points to ancient origins of this signaling pathway in energy regulation . Studying Prokr2's role may reveal how the hypothalamus evolved as a central integrator of multiple physiological systems including metabolism, thermoregulation, and circadian timing.

This evolutionary perspective on Prokr2 function not only enhances our basic understanding of energy homeostasis but could also inspire biomimetic approaches to inducing controlled hypometabolic states for medical applications by leveraging naturally evolved mechanisms for energy conservation.

What are the key takeaways regarding Prokr2 function for researchers entering this field?

Researchers entering the field of Prokr2 research should understand several key concepts that define our current understanding of this receptor's function:

These foundational concepts provide essential context for researchers designing experiments, interpreting results, and developing new hypotheses in the field of Prokr2 research.

How does current knowledge about Prokr2 integrate with broader understanding of hypothalamic regulation of physiology?

Current knowledge about Prokr2 significantly enhances our understanding of hypothalamic regulation of physiology, providing insights into how this brain region coordinates multiple physiological systems:

  • Integration of Multiple Regulatory Systems: Prokr2 exemplifies how the hypothalamus simultaneously regulates multiple physiological systems including circadian rhythms, energy metabolism, and thermoregulation . The expression of Prokr2 in both the suprachiasmatic nucleus (SCN) and its hypothalamic targets demonstrates the molecular mechanisms through which these different regulatory functions are coordinated.

  • Hierarchical Organizational Model: The role of Prokr2 as both an output signal from the SCN and a local synchronizing factor supports a hierarchical model of hypothalamic regulation, where the SCN serves as a master pacemaker that coordinates the activity of subordinate hypothalamic nuclei controlling specific physiological functions . This hierarchical organization enables temporal coordination of diverse physiological processes.

  • Energy Sensing and Homeostatic Defense: The enhanced sensitivity of Prokr2 knockout mice to food deprivation illustrates how the hypothalamus incorporates energy sensing into its regulatory functions . Prokr2 signaling appears to be part of the molecular machinery through which the hypothalamus defends against energy deficits, preventing excessive energy conservation responses when resources are adequate.

  • Threshold Phenomena in Hypothalamic Control: The spontaneous torpor in Prokr2 knockout mice represents a threshold phenomenon, where the absence of this inhibitory signal allows animals to cross a regulatory threshold into a distinct physiological state . This supports conceptual models of hypothalamic regulation involving discrete physiological states separated by regulatory thresholds rather than simply continuous variable control.

  • Circadian-Metabolic Crosstalk: The dual involvement of Prokr2 in circadian and metabolic regulation exemplifies the extensive crosstalk between these systems within the hypothalamus . This interconnection ensures that metabolic processes are appropriately timed relative to environmental cycles and behavioral states, optimizing energy utilization.

  • Permissive vs. Instructive Signaling: The role of Prokr2 in torpor regulation suggests it functions as a permissive rather than instructive signal, where its presence prevents torpor but its absence allows rather than induces this state . This highlights the complex logic of hypothalamic regulation, involving both activating and inhibitory signals that interact to determine physiological outcomes.

  • Individual Variation in Hypothalamic Control: The sporadic nature of torpor bouts in Prokr2 knockout mice, with substantial individual variation, reflects the complexity of hypothalamic regulation where multiple redundant pathways and individual differences in sensitivity contribute to phenotypic variability .

This integration of Prokr2 research with broader hypothalamic physiology provides a more comprehensive understanding of how this brain region coordinates multiple aspects of organismal function across different timescales and physiological challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.