Recombinant Mouse Proline-rich transmembrane protein 1 (Prrt1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Prrt1; Ng5; Proline-rich transmembrane protein 1; Dispanin subfamily D member 1; DSPD1; Synapse differentiation-induced protein 4; SynDIG4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Prrt1
Target Protein Sequence
MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLG AGGLASAAASAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAPTAQAPGFVVPTHAGAVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGPGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDLVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP
Uniprot No.

Target Background

Function

Function: Maintains a pool of extrasynaptic AMPA-regulated glutamate receptors (AMPARs) crucial for synapse development and function. It regulates AMPAR function and synaptic transmission during development but is not essential at mature hippocampal synapses. It plays a role in regulating basal phosphorylation levels of glutamate receptor GRIA1 and promotes GRIA1 and GRIA2 cell surface expression.

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell junction, synapse.
Tissue Specificity
Expressed in the brain (at protein level). In brain, expressed throughout the hippocampus with weak expression in the olfactory bulb and neocortex (at protein level).

Q&A

What is Proline-rich transmembrane protein 1 (PRRT1) and what protein families does it belong to?

PRRT1, also known as SynDIG4, belongs to both the SynDIG protein family and the larger Dispanin family, which contains other proteins with homologous transmembrane regions . PRRT1 has been identified as an important component of native AMPAR (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor) complexes through multiple large-scale proteomics investigations . It plays a significant role in regulating AMPAR function and synaptic plasticity in the central nervous system.

What experimental approaches are recommended for detecting PRRT1 expression in mouse brain tissue?

For detecting PRRT1 expression in mouse brain tissue, researchers should consider:

  • Immunohistochemistry/Immunofluorescence: Using specific antibodies against PRRT1 with MAP2 as a dendritic marker for co-localization studies. This approach reveals that PRRT1 shows robust co-localization with GluA1 in dendrites, with approximately 36.3% ± 4% of GluA1 overlapping with PRRT1, while 41.2% ± 2.6% of PRRT1 co-localizes with GluA1 .

  • Western blotting: For quantitative analysis of PRRT1 expression levels in different brain regions or under various experimental conditions.

  • RT-PCR/qPCR: To evaluate PRRT1 mRNA expression levels.

  • In situ hybridization: For visualizing the spatial distribution of PRRT1 mRNA expression in brain tissue sections.

How does PRRT1 interact with AMPA receptor subunits?

PRRT1 physically interacts with all four AMPAR subunits (GluA1-GluA4) as demonstrated through co-immunoprecipitation experiments in HEK293 cells expressing PRRT1 and individual AMPAR subunits . The interaction appears to be mediated primarily through the transmembrane region of PRRT1, with additional contributions from its intracellular loop . Deletion studies using PRRT1 constructs (PRRT1-CΔ34, PRRT1-CΔ60, and PRRT1-NΔ144) revealed that while full-length PRRT1 and PRRT1-NΔ144 interact strongly with GluA1, mutations affecting the transmembrane domain significantly weaken or abolish this interaction .

What are the recommended protocols for studying PRRT1 knockout effects on synaptic plasticity?

When designing experiments to study PRRT1 knockout effects on synaptic plasticity, researchers should consider the following approach:

  • Generation of PRRT1 knockout models: Either through traditional knockout strategies or CRISPR/Cas9 genome editing.

  • Electrophysiological recordings: To measure:

    • Single tetanus-induced NMDAR-dependent long-term potentiation (LTP)

    • NMDAR-dependent long-term depression (LTD)

    • Baseline synaptic transmission at mature synapses

  • Analysis timeline: PRRT1 appears dispensable for synaptic transmission at mature synapses but is required for specific forms of synaptic plasticity . Therefore, experimental protocols should include both baseline measurements and plasticity induction paradigms.

  • Controls: Include wild-type littermates and appropriate sham conditions.

  • Quantification parameters:

    • Field potential amplitudes

    • Paired-pulse ratios

    • AMPAR-mediated current amplitudes and kinetics

Previous research has demonstrated that PRRT1 deletion affects both LTP and LTD, suggesting its critical role in bidirectional synaptic plasticity mechanisms .

What methodological approaches are effective for investigating PRRT1's subcellular localization?

For investigating PRRT1's subcellular localization, the following methodological approaches are recommended:

  • Immunocytochemical co-staining of cultured hippocampal neurons using:

    • Anti-PRRT1 antibodies

    • Markers for specific subcellular compartments (e.g., GluA1 for AMPARs, MAP2 for dendrites, VGLUT1 for presynaptic terminals)

  • Quantitative colocalization analysis:

    • Measure overlap coefficients between PRRT1 and compartment markers

    • Current data shows 41.2% ± 2.6% of PRRT1 co-localizes with GluA1, while only 15.6% ± 0.9% of PRRT1 overlaps with the presynaptic marker VGLUT1

  • Subcellular fractionation followed by western blotting to quantify PRRT1 distribution across different neuronal compartments.

  • Super-resolution microscopy techniques (STED, STORM, or PALM) to achieve nanoscale resolution of PRRT1 localization relative to synaptic markers.

  • Electron microscopy with immunogold labeling for ultrastructural localization.

Research indicates that while PRRT1 shows modest co-localization with synaptic markers (9.1% ± 0.9% of VGLUT1 co-localizes with PRRT1), it appears to reside predominantly in extrasynaptic compartments where it co-localizes with AMPARs .

How do post-translational modifications of PRRT1 affect its interaction with AMPA receptors?

While direct data on PRRT1 post-translational modifications is limited in the provided search results, research approaches should include:

  • Identification of potential modification sites:

    • Analyze PRRT1 sequence for consensus sites for phosphorylation, glycosylation, ubiquitination, etc.

    • Use bioinformatics tools to predict modification sites

  • Site-directed mutagenesis studies:

    • Generate PRRT1 constructs with mutations at predicted modification sites

    • Assess effects on AMPAR binding affinity through co-immunoprecipitation studies

    • Evaluate functional consequences through electrophysiological recordings

  • Mass spectrometry analysis:

    • Identify actual post-translational modifications of native and recombinant PRRT1

    • Compare modification patterns under different physiological conditions

  • Pharmacological manipulation:

    • Use kinase/phosphatase inhibitors to alter PRRT1 modification state

    • Assess consequences for AMPAR surface expression and function

Considering that PRRT1 differentially affects the stability of GluA1 phosphorylated at S845 and S831 sites , it's plausible that PRRT1's own phosphorylation state might regulate these interactions.

What mechanisms underlie PRRT1's differential effects on GluA1 phosphorylation at S845 versus S831 sites?

To investigate the mechanisms behind PRRT1's differential effects on GluA1 phosphorylation, researchers should consider:

  • Biochemical analysis:

    • Co-immunoprecipitation of PRRT1 with phosphorylated forms of GluA1

    • Western blotting with phospho-specific antibodies against GluA1-S845 and GluA1-S831

    • Comparison between wild-type and PRRT1 knockout tissues

  • Structural analysis:

    • Determine if PRRT1 binding to GluA1 sterically affects access of kinases/phosphatases to specific sites

    • Investigate potential conformational changes in GluA1 induced by PRRT1 binding

  • Kinase/phosphatase recruitment:

    • Assess if PRRT1 acts as a scaffold for specific kinases (PKA for S845, CaMKII/PKC for S831)

    • Examine if PRRT1 affects the localization or activity of phosphatases targeting these sites

  • Temporal dynamics:

    • Monitor phosphorylation kinetics at both sites in the presence and absence of PRRT1

    • Use phosphomimetic GluA1 mutants to determine if PRRT1 effects are upstream or downstream of phosphorylation

Previous research has shown that deletion of PRRT1 affects the stability of GluA1 phosphorylated at S845 and S831 sites , suggesting a mechanistic link between PRRT1 and the regulation of these critical phosphorylation events.

What are the optimal conditions for expressing and purifying recombinant mouse PRRT1 for structural studies?

For expressing and purifying recombinant mouse PRRT1 for structural studies:

  • Expression systems:

    • Mammalian cells (HEK293, CHO): Provides proper post-translational modifications and membrane insertion

    • Insect cells: Suitable for higher yields while maintaining most mammalian-like modifications

    • E. coli: May require optimization for membrane protein expression (e.g., using specific strains like C41/C43)

  • Construct design:

    • Consider adding affinity tags (His6, FLAG, etc.) for purification

    • For structural studies, removal of flexible regions might improve crystallization

    • Based on domain deletion studies, preserve the transmembrane domain and intracellular loop as these are critical for function

  • Solubilization conditions:

    • Test various detergents (DDM, LMNG, GDN) for optimal extraction while maintaining protein stability

    • Consider lipid nanodiscs or amphipols for maintaining a native-like membrane environment

  • Purification strategy:

    • Two-step affinity purification followed by size exclusion chromatography

    • Monitor protein quality by SEC-MALS, negative-stain EM, or thermal stability assays

  • Complex formation:

    • For co-crystallization with AMPAR subunits, co-expression or in vitro reconstitution approaches may be considered

    • Verify complex formation by analytical SEC and binding assays

How can PRRT1-specific antibodies be validated for research applications?

Thorough validation of PRRT1-specific antibodies is crucial for reliable research outcomes. The recommended validation approach includes:

  • Western blot validation:

    • Comparison of signal between wild-type and PRRT1 knockout samples

    • Expected molecular weight confirmation (with consideration of potential post-translational modifications)

    • Testing in different tissue types with known expression patterns

  • Immunofluorescence validation:

    • Parallel staining of wild-type and knockout tissues/cells

    • Co-localization with established markers (e.g., GluA1, as ~41.2% of PRRT1 co-localizes with GluA1)

    • Absorption tests with the immunizing peptide

  • Immunoprecipitation validation:

    • Confirmation that the antibody can pull down PRRT1 from brain lysates

    • Mass spectrometry verification of immunoprecipitated proteins

    • Capability to co-immunoprecipitate known interaction partners like AMPAR subunits

  • Cross-reactivity testing:

    • Against related family members (other SynDIG/Dispanin family proteins)

    • In tissues from different species if cross-species reactivity is claimed

  • Application-specific validation:

    • For each application (Western blotting, immunohistochemistry, IP, etc.), specific validation steps should be performed

    • Document lot-to-lot consistency through standard sample testing

What statistical approaches are appropriate for analyzing PRRT1 colocalization with synaptic markers?

When analyzing PRRT1 colocalization with synaptic markers, researchers should consider these statistical approaches:

  • Qualitative colocalization coefficients:

    • Pearson's correlation coefficient (PCC): Measures linear correlation between fluorescence intensities

    • Manders' overlap coefficient (MOC): Measures the fraction of pixels that overlap

    • Previous research reported that 36.3% ± 4% of GluA1 overlapped with PRRT1, while 41.2% ± 2.6% of PRRT1 co-localized with GluA1

  • Object-based analysis:

    • Nearest neighbor distances between PRRT1 and synaptic marker puncta

    • Center-of-mass distances between overlapping structures

    • Statistical testing comparing observed distributions with randomized controls

  • Appropriate controls:

    • Negative controls: Non-colocalizing proteins (PRRT1 showed only modest colocalization with VGLUT1)

    • Positive controls: Known interaction partners (PRRT1 strongly colocalizes with GluA1)

    • Randomized image analysis to establish significance thresholds

  • Sample size determination:

    • Analyze multiple cells (n ≥ 20) across multiple independent cultures/animals

    • Power analysis to determine required sample sizes for detecting biologically relevant differences

  • Reporting standards:

    • Clear description of methods used for setting thresholds and parameters

    • Reporting of both mean values and measures of dispersion (standard deviation or SEM)

    • Raw data availability for potential reanalysis

How can researchers differentiate between direct and indirect effects of PRRT1 on AMPAR trafficking?

To differentiate between direct and indirect effects of PRRT1 on AMPAR trafficking, researchers should implement the following methodological approaches:

  • Acute vs. chronic manipulation:

    • Compare acute knockdown (shRNA) vs. constitutive knockout effects

    • Use inducible expression/deletion systems to control timing of PRRT1 manipulation

    • Acute effects are more likely to represent direct mechanisms

  • Rescue experiments:

    • Express wild-type vs. mutant PRRT1 in knockout background

    • Domain-specific mutations (e.g., PRRT1-CΔ34, PRRT1-CΔ60, PRRT1-NΔ144) to identify regions essential for AMPAR trafficking

  • Direct binding assays:

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure binding kinetics

    • Determine if PRRT1 directly binds AMPAR subunits or requires intermediary proteins

    • Co-immunoprecipitation experiments have shown that PRRT1 can physically interact with all AMPAR subunits (GluA1-GluA4)

  • Live imaging approaches:

    • Single-particle tracking of AMPARs in presence/absence of PRRT1

    • FRAP (fluorescence recovery after photobleaching) to measure lateral mobility changes

    • Pulse-chase experiments to assess internalization/recycling rates

  • Biochemical trafficking assays:

    • Surface biotinylation to quantify surface/internal AMPAR ratio

    • Subcellular fractionation to track AMPAR distribution

    • Analysis of post-endocytic sorting in presence/absence of PRRT1

Previous research has established that deletion of PRRT1 leads to a decrease in surface levels of GluA1 and GluA2 , but distinguishing direct trafficking effects from indirect consequences requires these complementary approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.