Recombinant Mouse Prostaglandin D2 receptor (Ptgdr)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Prostaglandin D2 Receptor (Ptgdr)

The recombinant mouse prostaglandin D2 receptor (Ptgdr), also known as DP1, is a G protein-coupled receptor (GPCR) encoded by the Ptgdr gene. It serves as a primary receptor for prostaglandin D2 (PGD2), mediating diverse physiological and pathological processes, including immune regulation, inflammation, and neurodegeneration. Recombinant Ptgdr is engineered for use in laboratory settings to study receptor-ligand interactions, signal transduction pathways, and therapeutic potential.

Genomic Organization

FeatureDetailSource
Chromosome14
Exons5
Introns4
Molecular Weight~40–44 kDa (inferred from human homolog)
Amino Acids~359 (human homolog, mouse likely similar)

The Ptgdr gene in mice shares structural homology with its human counterpart (PTGDR), including conserved exons and introns. The receptor contains seven transmembrane domains characteristic of GPCRs, with extracellular N-glycosylation sites (Asn-10, Asn-90, Asn-297) and intracellular phosphorylation sites for protein kinase C .

Functional Roles and Signaling Pathways

Ptgdr primarily couples with Gs proteins, activating adenylate cyclase to elevate intracellular cyclic AMP (cAMP) and mobilize calcium ions . This signaling is critical for:

RoleMechanismSource
Immune RegulationInhibits dendritic cell migration, promotes eosinophil apoptosis
Viral ClearanceDP1 knockout in macrophages enhances phagocytosis and rapid virus clearance
InflammationModulates TH2 cell responses and eosinophil activation

In contrast to DP2 (CRTH2), which couples with Gi proteins to reduce cAMP, Ptgdr (DP1) exerts anti-inflammatory effects by suppressing inflammatory cell recruitment .

Expression and Tissue Distribution

Ptgdr is expressed in immune and neural tissues, as summarized below:

TissueExpression ProfileSource
Immune CellsMast cells, basophils, eosinophils, TH2 cells
BrainMeninges, thalamus, hippocampus, cerebellum
Reproductive OrgansPlacenta, testes

In Alzheimer’s disease models (e.g., TgF344-AD rats), PGD2 levels and DP1/DP2 receptor distributions shift, suggesting therapeutic targeting potential .

Research Applications and Experimental Uses

Recombinant Ptgdr is utilized in:

ApplicationMethodSource
Antibody ValidationBlocking assays with control fragments (e.g., aa 285–309)
Receptor Binding AssaysStudying PGD2 interaction kinetics
Knockout ModelsInvestigating DP1-specific immune responses

For example, DP1-deficient macrophages exhibit enhanced phagocytic activity, accelerating viral clearance in murine models .

Asthma

Ptgdr regulates airway inflammation by inhibiting eosinophil survival and dendritic cell migration, positioning it as a target for anti-asthmatic therapies .

Neurodegeneration

PGD2 signaling via DP1 has been implicated in Parkinson’s disease-like pathology in mice, suggesting caution in therapeutic modulation .

Alzheimer’s Disease

While DP2 antagonists (e.g., timapiprant) show promise in rat models, DP1’s role in neuroinflammation remains under investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice packs by default. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Ptgdr; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Ptgdr
Target Protein Sequence
MNESYRCQTSTWVERGSSATMGAVLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTDLLGKCLISPMVLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTL QLLAMAVECWLSLGHPFFYQRHVTLRRGVLVAPVVAAFCLAFCALPFAGFGKFVQYCPGT WCFIQMIHKERSFSVIGFSVLYSSLMALLVLATVVCNLGAMYNLYDMHRRQRHYPHRCSR DRAQSGSDYRHGSLHPLEELDHFVLLALMTVLFTMCSLPLIYRAYYGAFKLENKAEGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKVFTRPLIYRNWSSHSQQSNVESTL
Uniprot No.

Target Background

Function

The Prostaglandin D2 receptor (PTGDR) is a receptor for prostaglandin D2 (PGD2). Its primary signaling pathway involves Gs proteins, which stimulate adenylate cyclase, leading to increased intracellular cAMP levels. Calcium mobilization is also observed, independent of inositol 1,4,5-trisphosphate production. PTGDR plays a role in PLA2G3-dependent mast cell maturation. Immature mast cells secrete PLA2G3, which acts on nearby fibroblasts to synthesize PGD2, subsequently promoting mast cell maturation and degranulation via PTGDR.

Gene References Into Functions
  1. PGD2 signaling via the DP1 receptor is crucial for optimal microglia/macrophage activation and IFN expression following neurotropic coronavirus infection. PMID: 28630327
  2. PGD2 signals through PTGDR contribute to the suppression of intestinal tumors. PMID: 24729479
  3. A PLA2G3-lipocalin-type PGD2 synthase (L-PGDS)-PGD2 receptor DP1 pathway drives mast cell maturation. PMID: 23624557
  4. PGD2-DP signaling reduces vascular permeability in vivo. PMID: 23307871
  5. While platelet DP1 is absent in mice, DP1 deletion exacerbates aneurysm formation, the hypertensive response to Ang II, and accelerates atherogenesis and thrombogenesis. PMID: 22406532
  6. The functional roles of PGD2 and its receptors vary depending on the inflammatory context in chronic skin inflammation, chronic contact hypersensitivity, and IgE-mediated chronic allergic skin inflammation. PMID: 21943706
  7. Amino acid sequence alignment of human, mouse, and rat DP receptors. PMID: 12895603
  8. Following epicutaneous sensitization with ovalbumin (OVA), DP activation inhibits Langerhans cell (LC) migration and affects the priming of antigen-specific T cells in draining lymph nodes. PMID: 15004188
  9. Prostaglandin D receptor mutant mice exhibit increased pain sensitivity. PMID: 18938093
Database Links

KEGG: mmu:19214

STRING: 10090.ENSMUSP00000093653

UniGene: Mm.5105

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundantly expressed in the ileum, followed by lung, stomach and uterus.

Q&A

What is the Prostaglandin D2 receptor (Ptgdr) and its function?

Prostaglandin D2 receptors (Ptgdr) are G protein-coupled receptors that bind and are activated by prostaglandin D2 (PGD2). These receptors, also known as PTGDR or DP receptors, play important roles in various functions of the nervous system and inflammation . In mice and humans, there are two distinct PGD2 receptors: DP1 (PTGDR1) and DP2 (PTGDR2, also known as CRTH2) .

These receptors mediate diverse physiological and pathological responses. For instance, the PGD2-CRTH2 pathway has been demonstrated to promote the in vivo accumulation of type 2 innate lymphoid cells (ILC2s) in the lung during inflammatory conditions . Additionally, PGD2 signaling through these receptors has been implicated in allergic diseases and may contribute to vascular conditions such as abdominal aortic aneurysm (AAA) .

What are the main differences between DP1 and DP2 receptors?

The two primary prostaglandin D2 receptors differ significantly in their signaling mechanisms and biological functions:

DP1 (PTGDR1):

  • Signals primarily through Gs alpha subunit activation

  • Activates adenylate cyclase, leading to increased cAMP levels

  • Expressed primarily in cells involved in allergic and inflammatory reactions, including mast cells, basophils, eosinophils, Th2 cells, and dendritic cells

  • Also expressed in airway epithelial cells, vascular endothelium, and mucus-secreting goblet cells

  • Binds PGD2 with high affinity at concentrations in the 0.5-1 nanomolar range

DP2/CRTH2 (PTGDR2):

  • Signals through different G protein pathways than DP1

  • Expressed on ILC2s and regulates their accumulation in inflammatory conditions

  • Expressed in mast cells (34% of mast cells in human nasal polyps showed DP2 expression)

  • Primarily found intracellularly in mast cells rather than on the cell surface

  • Agonists such as DK-PGD2 and 15R-15-methyl PGD2 can induce intracellular calcium mobilization through this receptor

Importantly, PGD2 signaling through DP1 and DP2 can mediate different and often opposite effects in many immune system cell types .

How is the Ptgdr gene structured and where is it expressed?

Gene Structure:

  • The PTGDR gene (encoding DP1) in humans is located on chromosome 14 at position q22.1 (14q22.1)

  • The gene consists of 4 introns and 5 exons

  • It encodes for a protein of approximately 44 kilodaltons

  • Multiple alternatively spliced transcript variants exist

Expression Pattern:

  • In mice, DP1 protein is expressed in placenta and testes

  • mRNA transcripts have been detected in multiple regions of the mouse brain, including:

    • Meninges (confirmed by multiple reports)

    • Thalamus

    • Hippocampus

    • Cerebellum

    • Brainstem

    • Retina

  • In humans and rodents, DP1 is expressed in cells involved in allergic and inflammatory reactions:

    • Mast cells

    • Basophils

    • Eosinophils

    • Th2 cells

    • Dendritic cells

    • Airway epithelial cells

    • Vascular endothelium

    • Mucus-secreting goblet cells in nasal and colonic mucosa

    • Serous gland cells of the nose

Of note, the 14q22.1 chromosomal locus has been associated with asthma and other allergic disorders .

What signaling pathways are associated with Ptgdr activation?

The signaling pathways associated with Ptgdr activation depend on which receptor subtype is activated:

DP1 Signaling Pathway:

  • PGD2 binds to the extracellular ligand site on the DP1 receptor

  • This binding activates the Gs alpha subunit

  • The activated Gs alpha subunit prompts activation of adenylate cyclase on the cell membrane

  • Adenylate cyclase catalyzes the conversion of ATP to cyclic AMP (cAMP)

  • The result is increased levels of the second messenger cAMP, which can trigger various downstream cellular responses depending on the activated cell type

This signaling mechanism is particularly important in inflammatory and allergic responses, as it modulates the activity of cells involved in these processes.

DP2/CRTH2 Signaling Pathway:

  • In mast cells, DP2 agonists (like DK-PGD2 and 15R-15-methyl PGD2) induce dose-dependent intracellular calcium mobilization

  • This calcium mobilization is abrogated by pertussis toxin, suggesting coupling to Gi/o type G proteins

  • Unlike DP1, DP2 activation does not primarily increase cAMP levels

These different signaling pathways explain why PGD2 can have diverse and sometimes opposite effects on different cell types in the immune system.

What techniques are effective for studying Ptgdr expression in mouse models?

Several methodologies have proven effective for investigating Ptgdr expression in mouse models:

Genetic Approaches:

  • Knockout mouse models (both heterozygous and homozygous) allow for functional studies of DP1 and DP2 receptors in various disease contexts, such as abdominal aortic aneurysm (AAA) formation induced by angiotensin II infusion or calcium chloride application

  • Reporter gene constructs linked to the Ptgdr promoter can be useful for tracking expression patterns in vivo

Tissue Analysis Techniques:

  • Immunohistochemistry can detect receptor protein expression in tissue sections, as demonstrated in studies of DP2 expression in human nasal polyps (showing 34% of mast cells expressing DP2)

  • In situ hybridization allows for visualization of mRNA expression patterns in specific tissues

Cellular Analyses:

  • Flow cytometry can assess receptor expression at the cellular level, as shown in studies detecting intracellular DP2 in LAD2 human mast cell lines (87%) and primary cultured human mast cells (98%)

  • Imaging flow cytometry provides single-cell analysis of receptor localization, useful for determining whether receptors are expressed intracellularly or on the cell surface

Molecular Biology Techniques:

  • RT-PCR and qPCR for quantitative assessment of mRNA expression levels

  • Western blotting for protein expression analysis

  • RNA sequencing for comprehensive transcriptomic profiling

For studying the dynamic regulation of receptor expression, combining multiple techniques is often most informative. For instance, research has shown that a significant proportion of ILC2s from healthy human peripheral blood express CRTH2 (DP2), while a smaller proportion of ILC2s from non-diseased human lung expressed this receptor, suggesting tissue-specific regulatory mechanisms .

How can researchers effectively generate and validate recombinant mouse Ptgdr?

Generating and validating recombinant mouse Ptgdr requires careful attention to several key methodological considerations:

Expression System Selection:

  • Mammalian expression systems (e.g., HEK293, CHO cells) are preferred for proper folding and post-translational modifications of GPCRs

  • Consider using systems that enable controlled induction of expression

  • For functional studies, stable cell lines may provide more consistent results than transient expression

Construct Design:

  • Include appropriate epitope tags (e.g., FLAG, His, HA) for detection and purification

  • Consider incorporating a signal sequence to ensure proper membrane localization

  • For structure-function studies, design constructs with specific mutations based on the known structure of the receptor, which includes seven rhodopsin-like transmembrane domains

  • Account for potential N-glycosylation sites (equivalent to the human sites at Asn-10, Asn-90, and Asn-297)

Validation Approaches:

  • Expression verification:

    • Western blotting to confirm protein expression at the expected molecular weight (~40-44 kDa)

    • Flow cytometry to assess cellular expression levels

    • Immunofluorescence microscopy to confirm membrane localization

  • Functional validation:

    • Ligand binding assays using labeled PGD2 or synthetic agonists

    • cAMP assays for DP1 functionality (should show increased cAMP upon stimulation)

    • Calcium mobilization assays for DP2 functionality (can be abrogated by pertussis toxin)

    • Verification that PGD2 binds with higher affinity than other prostanoids like PGE2

  • Specificity controls:

    • Competitive binding assays with known agonists and antagonists

    • Comparison of response to the relative potency hierarchy: PGD2>>PGE2>PGF2α>PGI2=thromboxane A2

    • Testing non-transfected cells in parallel to control for endogenous receptor expression

For recombinant receptors intended for in vivo studies, additional validation in relevant cellular contexts may be necessary to ensure physiological relevance of the findings.

What are the optimal conditions for studying Ptgdr function in vitro?

Optimizing conditions for in vitro studies of Ptgdr function requires attention to several key parameters:

Cell System Selection:

  • Primary cells expressing endogenous receptors provide the most physiologically relevant context

  • Cell lines with stable expression offer greater consistency across experiments

  • Consider the background signaling environment of the chosen cell type, as this may affect receptor function

Culture and Assay Conditions:

  • Temperature: Standard mammalian conditions (37°C) are typically used

  • pH: Maintain physiological pH (7.2-7.4) as GPCRs are sensitive to pH changes

  • Medium composition: Control for factors that might influence prostaglandin synthesis or degradation

  • Serum considerations: Serum contains various lipid mediators that could interfere with studies; serum starvation before stimulation may be necessary

Receptor Expression Management:

  • For recombinant systems, use inducible promoters to control expression levels

  • Over-expression can lead to constitutive activity or non-physiological responses

  • Consider blocking endogenous PGD2 production with aspirin to prevent autocrine activation, though research has shown this may not induce surface expression of DP2 in human mast cells

Stimulation Parameters:

  • Concentration ranges: Use physiologically relevant concentrations of PGD2 (0.5-1 nM range for DP1)

  • Time course considerations: Both acute and prolonged stimulation may be relevant depending on the biological process under study

  • Consider using selective agonists to differentiate between DP1 and DP2 responses:

    • For DP2: DK-PGD2 and 15R-15-methyl PGD2 induce dose-dependent intracellular calcium mobilization

    • For DP1: Use selective agonists that activate adenylate cyclase

Readout Selection:

  • For DP1 signaling: cAMP assays using ELISA, TR-FRET, or real-time luminescence reporters

  • For DP2 signaling: Calcium flux assays using fluorescent indicators

  • Downstream pathway activation: Phosphorylation of target proteins by Western blotting

  • Functional responses: Cell migration, cytokine production, or other relevant cellular functions

Controls and Validation:

  • Include positive controls (known agonists at established effective concentrations)

  • Include negative controls (vehicle, non-transfected cells)

  • Use selective antagonists to confirm receptor specificity

  • Consider genetic approaches (siRNA knockdown, CRISPR knockout) as additional specificity controls

What approaches are used to measure Ptgdr activation and signaling?

Multiple methodological approaches can be employed to measure Ptgdr activation and downstream signaling events:

Ligand Binding Assays:

  • Radioligand binding using tritiated or iodinated PGD2

  • Competitive binding assays with unlabeled ligands to determine relative binding affinities

  • Surface plasmon resonance (SPR) for real-time binding kinetics

Second Messenger Assays:

  • For DP1 activation:

    • cAMP accumulation assays using ELISA, TR-FRET, or bioluminescence-based methods

    • Protein kinase A (PKA) activity assays as a downstream readout of cAMP signaling

    • CREB phosphorylation as a nuclear readout of cAMP pathway activation

  • For DP2 activation:

    • Intracellular calcium mobilization using fluorescent indicators like Fura-2 or Fluo-4

    • Inhibition assays with pertussis toxin to confirm Gi/o-mediated signaling

    • Measurement of decreased cAMP levels (if the cell type has high basal adenylyl cyclase activity)

G Protein Activation Assays:

  • GTPγS binding assays to measure G protein activation directly

  • BRET/FRET-based assays for real-time monitoring of receptor-G protein interactions

  • Co-immunoprecipitation of receptors with specific G protein subunits

Downstream Signaling Pathways:

  • Western blotting for phosphorylation of pathway-specific targets

  • Reporter gene assays for transcriptional responses

  • Protein kinase C phosphorylation at sites in the first and second cytoplasmic loops and COOH terminus of the receptor

Functional Cellular Assays:

  • Cell migration assays (particularly relevant for immune cells like ILC2s)

  • Flow cytometry to assess receptor internalization or surface expression changes

  • Cytokine production measurement via ELISA or multiplex bead arrays

  • For ILC2s: assessment of accumulation in tissues such as lung following in vivo challenges

Advanced Imaging Approaches:

  • Fluorescent protein fusion constructs to visualize receptor localization and trafficking

  • Single-molecule imaging to assess receptor clustering and organization

  • FRET-based sensors to monitor conformational changes in real-time

An integrative approach combining multiple techniques often provides the most comprehensive understanding of receptor activation and signaling dynamics in different cellular contexts.

How should researchers design experiments to study Ptgdr in inflammation models?

Designing robust experiments to study Ptgdr in inflammation models requires careful consideration of several key factors:

Model Selection:

  • Choose inflammation models relevant to known Ptgdr functions:

    • Allergic airway inflammation models (given the role of PGD2-CRTH2 in ILC2 accumulation in lungs)

    • Vascular inflammation models such as abdominal aortic aneurysm (AAA) induced by angiotensin II infusion or calcium chloride application

    • Skin inflammation models for studying mast cell responses

Genetic Approaches:

  • Utilize DP1-deficient mice (both heterozygous and homozygous) to assess receptor function in specific disease contexts

  • Consider conditional knockout approaches to study tissue-specific effects

  • Use reporter mice to track cells expressing Ptgdr during inflammatory processes

Pharmacological Interventions:

  • Employ selective inhibitors of either DP1 or DP2 to distinguish receptor-specific effects

  • Consider timing of intervention (prophylactic vs. therapeutic)

  • Use appropriate dosing based on published pharmacokinetic data

  • Include vehicle controls and dose-response studies

Temporal Considerations:

  • Establish appropriate time points for analysis based on the kinetics of the inflammatory process

  • Include both acute and chronic models where relevant

  • Consider the dynamic regulation of receptor expression during inflammation

Analytical Endpoints:

  • Cellular analysis:

    • Flow cytometry to quantify inflammatory cell recruitment (ILC2s, mast cells, etc.)

    • Histological assessment of tissue inflammation and injury

    • Immunohistochemistry to assess receptor expression in situ

  • Molecular analysis:

    • Cytokine and chemokine profiling in tissue and biological fluids

    • Gene expression analysis focusing on inflammatory mediators

    • Protein analysis by Western blotting or ELISA

  • Functional readouts:

    • Physiological parameters relevant to the model (e.g., airway hyperresponsiveness)

    • Vascular integrity assessments in AAA models

    • Behavioral assessments in neuroinflammation models

Experimental Table Design Example:

Experimental GroupGenotypeTreatmentDurationPrimary EndpointsSecondary Endpoints
ControlWild-typeVehicleX daysInflammatory cell countsHistopathology
Disease modelWild-typeInflammatory stimulusX daysInflammatory cell countsHistopathology
DP1 KODP1-/-Inflammatory stimulusX daysInflammatory cell countsHistopathology
DP2 inhibitionWild-typeInflammatory stimulus + DP2 antagonistX daysInflammatory cell countsHistopathology
CombinationDP1-/-Inflammatory stimulus + DP2 antagonistX daysInflammatory cell countsHistopathology

What controls are essential in Ptgdr knockout or inhibition studies?

Rigorous experimental controls are critical for accurate interpretation of Ptgdr knockout or inhibition studies:

Genetic Model Controls:

  • Wild-type littermates as the primary control group for knockout studies

  • Heterozygous animals to assess gene dosage effects

  • Verification of knockout efficiency by genotyping, mRNA analysis, and protein expression

  • Assessment of compensatory changes in related pathways (e.g., expression of other prostaglandin receptors)

  • Age and sex-matched controls to account for these biological variables

Pharmacological Inhibition Controls:

  • Vehicle-treated groups matched for administration route, volume, and frequency

  • Dose-response studies to establish optimal inhibitor concentrations

  • Time-course experiments to determine optimal treatment timing

  • Verification of target engagement using biochemical or cellular assays

  • Off-target effect assessment using knockout animals treated with the inhibitor

Disease Model Controls:

  • Sham-operated or vehicle-treated animals for surgical or chemical induction models

  • Healthy tissue controls for comparison with inflamed tissues

  • Positive control groups using established interventions with known effects

Experimental Validation Controls:

  • Independent verification using both genetic and pharmacological approaches

  • Use of multiple inhibitors with different chemical structures but same target specificity

  • Rescue experiments (e.g., reconstitution of knockout phenotype with exogenous receptor expression)

  • Inclusion of known DP1 and DP2 receptor ligands as reference compounds:

    • PGD2 (principal endogenous ligand for both receptors)

    • DP1-selective agonists

    • DP2-selective agonists such as DK-PGD2 and 15R-15-methyl PGD2

Technical Controls:

  • Assay-specific controls (standard curves, quality controls)

  • Blinding of investigators to treatment groups during analysis

  • Randomization of animals to experimental groups

  • Sample size calculations based on expected effect sizes and variability

Experimental Design Table Example:

Control TypePurposeImplementation
GeneticBaseline comparisonWild-type littermates
GeneticGene dosage effectsHeterozygous animals
PharmacologicalBaseline comparisonVehicle-treated groups
PharmacologicalSpecificity verificationMultiple inhibitors with same target
Disease modelBaseline tissue functionSham-operated animals
ValidationCross-approach verificationBoth genetic and pharmacological approaches
TechnicalReduce biasBlinding and randomization

How can researchers differentiate between DP1 and DP2 signaling effects in their experiments?

Differentiating between DP1 and DP2 signaling effects requires strategic experimental approaches:

Receptor-Selective Pharmacological Tools:

  • Use selective agonists:

    • DP1-selective agonists (e.g., BW245C)

    • DP2-selective agonists (e.g., DK-PGD2, 15R-15-methyl PGD2)

  • Use selective antagonists:

    • DP1-selective antagonists (e.g., BWA868C)

    • DP2-selective antagonists (e.g., CAY10471, OC000459)

  • Confirm selectivity with dose-response studies showing expected potency differences between receptors

Genetic Approaches:

  • Use receptor-specific knockout models:

    • DP1-deficient mice (both heterozygous and homozygous)

    • DP2-deficient mice

    • Double-knockout mice for comparison

  • Use siRNA or shRNA for targeted knockdown in in vitro systems

  • CRISPR/Cas9 gene editing for precise receptor modifications

Pathway-Specific Analysis:

  • Measure distinct second messengers:

    • cAMP elevation for DP1 activation (Gs-coupled)

    • Calcium mobilization for DP2 activation (can be abrogated by pertussis toxin, indicating Gi-coupling)

  • Use pathway inhibitors:

    • PKA inhibitors to block DP1 downstream signaling

    • Pertussis toxin to block DP2 signaling through Gi proteins

    • Specific inhibitors of downstream effectors

Cellular Expression Patterns:

  • Take advantage of differential expression patterns of DP1 and DP2

  • Target cell types known to preferentially express one receptor:

    • For studying DP2, focus on ILC2s in which CRTH2 regulates accumulation in the lung

    • For DP1, focus on cell types with minimal DP2 expression

  • Verify receptor expression profiles in your experimental system before interpretation

Temporal Signaling Dynamics:

  • Explore different time points, as DP1 and DP2 may exhibit different activation kinetics

  • Assess both immediate responses (seconds to minutes) and delayed responses (hours to days)

  • Consider receptor desensitization and internalization patterns, which may differ between subtypes

Functional Readouts:

  • Identify cellular responses specifically linked to each receptor:

    • DP2 activation regulates ILC2 accumulation in lung during inflammation

    • Differential effects on cytokine production profiles

    • Opposite effects on cell migration or activation

Experimental Design Table Example:

ApproachDP1-Specific MethodDP2-Specific MethodReadout
PharmacologicalDP1-selective agonistDP2-selective agonistFunctional response
GeneticDP1 knockout miceDP2 knockout miceIn vivo phenotype
SignalingcAMP assayCalcium flux assay (+ pertussis toxin)Second messenger
Cell selectionDP1-predominant cellsILC2s, mast cellsCell-specific response

What considerations are important when studying Ptgdr in tissue-specific contexts?

Studying Ptgdr in tissue-specific contexts requires careful attention to several important considerations:

Tissue-Specific Expression Patterns:

Cellular Composition Analysis:

  • Identify which cell types within the tissue express Ptgdr:

    • In lung tissue, consider ILC2s which express CRTH2 and accumulate during inflammation

    • In nasal polyps, approximately 34% of mast cells express DP2

    • Determine whether expression is constitutive or induced during pathological states

Microenvironment Factors:

  • Assess local production of PGD2 by relevant cells:

    • Mast cells are major sources of PGD2 in many tissues

    • Consider how tissue inflammation may alter local PGD2 levels

  • Evaluate the presence of competing ligands or modulating factors

  • Consider tissue-specific pH, oxygen levels, and other factors that may affect receptor function

Tissue Accessibility Considerations:

  • For in vivo studies, consider drug delivery to specific tissues:

    • Blood-brain barrier considerations for CNS studies

    • Lung-specific delivery for respiratory studies

    • Consider using tissue-specific promoters for genetic manipulations

Physiological vs. Pathological Context:

  • Distinguish between receptor roles in normal physiology vs. disease states:

    • Study both homeostatic and inflammatory conditions

    • Consider that receptor expression or function may change during disease progression

    • Temporal changes in different disease phases may be important

Tissue-Specific Functional Readouts:

  • Select relevant functional parameters for each tissue:

    • For lung: airway hyperresponsiveness, inflammatory cell infiltration

    • For vascular tissues: vessel integrity, aneurysm formation in AAA models

    • For brain: region-specific signaling in areas where Ptgdr mRNA is expressed (meninges, thalamus, hippocampus, cerebellum, brainstem, retina)

Ex Vivo Approaches:

  • Consider tissue explant cultures to bridge in vitro and in vivo studies

  • Use tissue slices or precision-cut tissue sections to maintain native architecture

  • Organoids derived from specific tissues may recapitulate some aspects of tissue organization

Experimental Design Table for Tissue-Specific Studies:

TissueCell Types of InterestFunctional ReadoutsTissue-Specific Controls
LungILC2s, mast cells, epithelial cellsILC2 accumulation, airway hyperresponsivenessAirway-specific delivery controls
VascularEndothelial cells, smooth muscle cellsAneurysm formation, vessel integritySham-operated controls
NasalMast cells (34% express DP2)Inflammatory mediator releaseHealthy tissue comparison
BrainRegion-specific neural cellsRegion-specific functionsBlood-brain barrier considerations

How should researchers interpret contradictory findings in Ptgdr signaling studies?

Interpreting contradictory findings in Ptgdr signaling studies requires a systematic analytical approach:

Source of Contradictions Analysis:

  • Evaluate experimental model differences:

    • Species variations (mouse vs. human receptors may have different properties)

    • In vitro vs. in vivo studies (cellular context affects receptor function)

    • Acute vs. chronic stimulation (temporal signaling differences)

  • Consider receptor subtype specificity:

    • PGD2 signaling through DP1 and DP2 can mediate different and often opposite effects in many immune system cell types

    • Verify which receptor was predominantly studied in each contradictory finding

Methodological Considerations:

  • Assess differences in experimental techniques:

    • Receptor expression levels (overexpression vs. endogenous)

    • Ligand concentrations (physiological vs. pharmacological)

    • Readout sensitivity and specificity

  • Evaluate control adequacy in each study

  • Consider timing of measurements and signaling kinetics

Contextual Factors:

  • Cell type-specific effects:

    • Different cell types may have different signaling machinery

    • Background signaling environment varies between tissues

  • Microenvironmental influences:

    • Inflammatory vs. homeostatic conditions

    • Presence of other mediators affecting signaling

Receptor Regulation Dynamics:

  • Consider receptor expression dynamics:

    • A significant proportion of ILC2s from peripheral blood express CRTH2, while fewer ILC2s from lung tissue express this receptor

    • Expression may be dynamically regulated during cell migration or activation

  • Evaluate receptor localization:

    • In mast cells, DP2 is predominantly intracellular rather than surface-expressed

    • Trafficking between intracellular compartments and surface may vary with conditions

Integrated Data Analysis:

  • Systematically compare study parameters using tables or matrices

  • Weight findings based on methodological rigor and reproducibility

  • Consider meta-analysis approaches for multiple studies

  • Develop testable hypotheses to resolve contradictions

Resolution Strategies:

  • Design experiments that directly address contradictions:

    • Side-by-side comparison of different cell types or conditions

    • Sequential blockade of different signaling components

  • Consider that both findings may be correct in different contexts

  • Test whether contradictions are due to:

    • Biased signaling (different pathways activated by same receptor)

    • Receptor heteromerization with other GPCRs

    • Scaffold proteins affecting signaling outcomes

What statistical approaches are most appropriate for analyzing Ptgdr expression data?

Selecting appropriate statistical approaches for analyzing Ptgdr expression data depends on the experimental design and data characteristics:

Experimental Design Considerations:

  • For comparing expression between groups:

    • For normally distributed data: t-tests (two groups) or ANOVA (multiple groups)

    • For non-parametric data: Mann-Whitney U test (two groups) or Kruskal-Wallis (multiple groups)

  • For repeated measures designs:

    • Repeated measures ANOVA or mixed-effects models

    • Paired t-tests or Wilcoxon signed-rank tests for paired data

Correlation Analysis:

  • Pearson correlation for normally distributed data

  • Spearman correlation for non-parametric data

  • Multiple regression for multifactorial relationships

  • These approaches can be useful for relating Ptgdr expression to:

    • Disease severity metrics

    • Levels of inflammatory mediators

    • Expression of related genes or proteins

Multivariate Analysis:

  • Principal component analysis (PCA) to identify patterns in expression data

  • Cluster analysis to identify subgroups based on expression profiles

  • Particularly useful for analyzing:

    • Multi-receptor expression patterns

    • Tissue-specific expression signatures

    • Changes across disease progression

Data Normalization Strategies:

  • For qPCR data:

    • Use stable reference genes for normalization

    • Consider geometric mean of multiple reference genes

    • Validate reference gene stability in your experimental context

  • For protein expression:

    • Normalize to loading controls

    • Consider total protein normalization methods

Effect Size and Power Considerations:

  • Calculate effect sizes to determine biological significance

  • Conduct power analysis to determine appropriate sample sizes

  • Report confidence intervals in addition to p-values

  • Consider false discovery rate correction for multiple comparisons

Time Series Analysis:

  • For temporal expression changes:

    • Time series regression models

    • Area under the curve (AUC) analysis

    • Growth curve modeling

Data Visualization Approaches:

  • Box plots showing distribution and outliers

  • Violin plots for visualizing expression distribution

  • Heat maps for multivariate expression patterns

  • Forest plots for meta-analysis of multiple studies

Statistical Analysis Plan Example:

Data TypeStatistical TestAssumptionsSoftware Tools
qPCR expression (2 groups)Unpaired t-test or Mann-WhitneyNormality or non-parametricGraphPad Prism, R
Multiple group comparisonOne-way ANOVA with post-hocIndependence, normality, equal varianceSPSS, R
Correlation with clinical parametersPearson or SpearmanLinearity or monotonic relationshipR, GraphPad Prism
Expression across multiple tissuesMixed-effects modelAppropriate covariance structureR (lme4 package), SAS
Multi-gene expression patternsPrincipal component analysisLinear relationships, meaningful componentsR (factoextra package)

How can researchers validate the specificity of Ptgdr agonists and antagonists?

Validating the specificity of Ptgdr agonists and antagonists requires a comprehensive approach combining multiple methodologies:

Receptor Binding Studies:

  • Competitive binding assays:

    • Use radiolabeled or fluorescently labeled PGD2

    • Compare binding affinities (Ki values) for DP1 vs. DP2

    • Assess cross-reactivity with other prostanoid receptors

  • Saturation binding to determine Bmax and Kd values

  • Association/dissociation kinetics to characterize binding dynamics

Functional Selectivity Assessment:

  • Compare potency (EC50/IC50) across different assays:

    • cAMP production for DP1 activity

    • Calcium mobilization for DP2 activity

    • GTPγS binding for G protein activation

    • β-arrestin recruitment

  • Calculate selectivity ratios between receptor subtypes

  • Test on cells expressing only one receptor subtype

Genetic Validation Approaches:

  • Use receptor knockout models:

    • Test agonists/antagonists on DP1-deficient mice

    • Test on DP2-deficient systems

    • Responses should be abolished in the respective knockout

  • Use siRNA knockdown or CRISPR/Cas9 knockout in cell systems

  • Rescue experiments with receptor re-expression

Off-Target Screening:

  • Test compounds against a panel of related receptors:

    • Other prostanoid receptors (EP1-4, FP, IP, TP)

    • Structurally similar GPCRs

  • Employ broad pharmacological screening services

  • Consider proteomics approaches to identify unexpected binding partners

In Vivo Validation:

  • Compare phenotypes with genetic models:

    • Compound effects should mimic respective genetic modification

    • Effects should be absent in receptor knockout animals

  • Assess dose-dependent effects in relevant disease models

  • Monitor for unexpected side effects indicating off-target activity

Structure-Activity Relationship Studies:

  • Test chemically related compounds with slight structural modifications

  • Correlate structural features with selectivity profiles

  • Use computational modeling to predict binding interactions

Validation Data Presentation Example:

CompoundDP1 Binding (Ki)DP2 Binding (Ki)DP1/DP2 Selectivity RatiocAMP Response (EC50)Ca2+ Response (EC50)Effect in DP1-/- MiceOff-Target Activity
PGD20.5-1 nMx nM~1 (non-selective)y nMz nMPartially retainedEP receptors at high doses
DP1-selective agonista nM>1000 nM>1000b nMNo responseAbsentNone detected
DP2-selective agonist>1000 nMc nM>1000 (DP2)No responsed nMFully retainedNone detected

What are common pitfalls in interpreting Ptgdr-related experimental results?

Researchers should be aware of several common pitfalls when interpreting Ptgdr-related experimental results:

Receptor Subtype Confusion:

  • Failing to distinguish between DP1 and DP2 effects:

    • PGD2 activates both receptors with different downstream effects

    • These receptors can mediate opposite effects in the same cell types

  • Misinterpreting mixed responses due to co-expression of both receptors

  • Not accounting for species differences in receptor expression or signaling

Technical Limitations:

  • Over-reliance on single methodological approaches

  • Inadequate controls for antibody specificity in immunodetection

  • Poor validation of ligand selectivity

  • Lack of appropriate genetic controls (e.g., receptor knockouts)

Contextual Misinterpretation:

  • Ignoring tissue-specific or cell-specific differences:

    • Different proportions of ILC2s express CRTH2 in blood vs. lung tissue

    • Only 34% of mast cells in human nasal polyps express DP2

  • Overlooking receptor localization issues:

    • DP2 in mast cells is predominantly intracellular rather than surface-expressed

    • Receptor trafficking may be context-dependent

  • Neglecting the inflammatory state of the tissue or cells

Pharmacological Complexities:

  • Not accounting for ligand-specific signaling bias

  • Overlooking potential for receptor desensitization with prolonged exposure

  • Failing to consider metabolic conversion of PGD2 to other active compounds

  • Ignoring potential effects of endogenous PGD2 production:

    • Blocking endogenous PGD2 with aspirin affects baseline conditions

Oversimplified Pathway Analysis:

  • Focusing only on canonical signaling pathways:

    • DP1 primarily signals through Gs/cAMP

    • DP2 induces calcium mobilization via pertussis toxin-sensitive pathways

  • Missing pathway cross-talk or secondary signaling events

  • Ignoring temporal aspects of signaling cascades

Causation vs. Correlation Errors:

  • Assuming causation from correlation in expression studies

  • Not distinguishing between primary and secondary effects

  • Overlooking compensatory mechanisms in knockout models

Experimental Design Issues:

  • Inappropriate time points for dynamic processes

  • Use of non-physiological concentrations of ligands

  • Inadequate sample sizes for detecting subtle effects

  • Lack of appropriate statistical analysis for complex datasets

Translation Between Models:

  • Uncritical extrapolation between in vitro and in vivo findings

  • Assuming mouse findings directly translate to human biology

  • Overlooking strain-specific differences in mouse models

Common Pitfalls and Mitigation Strategies:

Pitfall CategorySpecific ExampleMitigation Strategy
Receptor confusionAttributing all PGD2 effects to one receptor subtypeUse receptor-selective tools and genetic models
Technical issuesPoor antibody validationInclude receptor knockout controls for specificity
Contextual misinterpretationIgnoring tissue-specific expression patternsVerify receptor expression in each experimental context
Pharmacological complexitiesNot accounting for ligand metabolitesInclude metabolic inhibitors or stable analogs
Oversimplified pathwaysFocusing only on cAMP for DP1Examine multiple signaling readouts
Causation errorsAssuming correlation implies causationUse genetic and pharmacological interventions
Design issuesNon-physiological concentrationsUse dose-response studies with relevant ranges
Translation issuesDirect mouse-to-human extrapolationValidate key findings in human systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.