Recombinant Mouse Prostaglandin E synthase (Ptges)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Biological Role

Prostaglandin E Synthase (Ptges) catalyzes the glutathione-dependent conversion of prostaglandin H2 (PGH2) to prostaglandin E2 (PGE2), a lipid mediator central to inflammation, pain, fever, and immune modulation . The mouse variant, encoded by the Ptges gene (UniProt: Q9JM51), is a 35.8 kDa membrane-associated protein belonging to the MAPEG (Membrane-Associated Proteins in Eicosanoid and Glutathione Metabolism) family .

PropertyDetails
Gene ID64292 (NCBI)
Protein Length153 amino acids
Subunit StructureHomotrimer
Subcellular LocalizationIntegral membrane protein (multi-pass)
Key DomainsGlutathione-binding site, catalytic domain for PGH2 isomerization

Ptges is co-expressed with cyclooxygenase-2 (COX-2) in activated macrophages and other immune cells, forming a coupled enzymatic pathway for PGE2 production during inflammation .

Enzyme Kinetics

Recombinant Ptges exhibits robust activity under physiological conditions:

  • Optimal pH: 7.0–8.0

  • Temperature Stability: Retains >90% activity at 4–25°C .

SubstrateKₘ (μM)Vₘₐₓ (nmol/min/mg)Catalytic Efficiency (kₐₜₜ/Kₘ)
PGH21306,2004.6 min⁻¹μM⁻¹
GSH37--

Inflammatory and Immune Studies

  • Collagen-Induced Arthritis: Ptges knockout mice show reduced PGE2 levels and attenuated arthritis severity, validating its role in inflammation .

  • T-Cell Polarization: Autocrine PGE2 from Ptges modulates Th17/Th1 cell differentiation via EP2/EP4 receptors, impacting autoimmune responses .

Cancer and Thrombosis

  • Melanoma: Ptges deletion reduces tumor-associated collagen deposition and enhances immunotherapy efficacy .

  • Venous Thrombosis: Gas6-induced Ptges upregulation in endothelial cells drives PGE2-mediated platelet activation, a mechanism blocked by EP3 receptor antagonists .

Neurological Disorders

  • Epilepsy and Stroke: Ptges-derived PGE2 exacerbates excitotoxic neuronal death via glutamate release, while its inhibition reduces hippocampal damage .

Comparative Analysis of Ptges Inhibitors

InhibitorMechanismIC₅₀Therapeutic Potential
MF63Competitive GSH antagonist0.8 μMAnti-inflammatory (preclinical)
LY3020371Allosteric site binding1.2 μMNeuroprotection (Phase II trials)
Natural flavonoidsRedox-active scavengers5–20 μMAdjunctive therapy

Challenges and Future Directions

While recombinant Ptges has advanced mechanistic studies, challenges persist:

  • Membrane Localization: Solubilization without loss of activity remains technically demanding .

  • Cell-Specific Roles: Tissue-specific knockout models are needed to disentangle systemic vs. localized PGE2 effects .

Emerging tools like cryo-EM and CRISPR-edited organoids promise deeper insights into Ptges regulation and therapeutic targeting .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag accordingly.
Synonyms
Ptges; Pges; Prostaglandin E synthase; mPGES-1; Glutathione peroxidase PTGES; Glutathione transferase PTGES; Microsomal prostaglandin E synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ptges
Target Protein Sequence
MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
Uniprot No.

Target Background

Function
Microsomal Prostaglandin E Synthase 1 (mPGES-1) is the terminal enzyme in the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. It catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli. mPGES-1 plays a crucial role in the inflammatory response, fever, and pain. It also catalyzes the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2. Additionally, mPGES-1 exhibits low glutathione transferase and glutathione-dependent peroxidase activities, towards 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively.
Gene References Into Functions
  1. mPGES-1 is essential for optimal Treg and Th17 responses during an antigen-driven primary immune response in vivo. PMID: 29237778
  2. mPGES-1 promotes an intercellular interaction between CD4+ T cells by upregulating the autocrine function of IL-1beta in experimental autoimmune encephalomyelitis. PMID: 29257087
  3. Deletion of the microsomal prostaglandin E synthase-1 gene impairs neuro-immune circuitry of the cholinergic anti-inflammatory pathway in endotoxaemic mouse spleen. PMID: 29470537
  4. COX-1 and mPGES-1 are co-localized in placental syncytiotrophoblasts-level II, facing fetal-placental circulation. PMID: 28487024
  5. Activation of the COX-2/mPGES-1/PGE2 cascade mediates uric acid-induced glomerular mesangial cell proliferation. PMID: 28052039
  6. mPGES-1 exerts a potentially protective effect against renal fibrosis and inflammation induced by unilateral ureteral obstruction in mice. PMID: 27784694
  7. Consistent with the acetyltransferase activity of p300, H3K27 acetylation was reduced after HDACi treatment, resulting in the formation of heterochromatin in the PTGES1 gene. In conclusion, HDAC activity maintains PTGES1 expression by recruiting p300 to its gene. PMID: 27913583
  8. The findings suggest that the COX-2/mPGES-1/PGE2 axis could be activated by albumin in proximal tubular cells via a NLRP3 inflammasome-mediated mechanism, potentially contributing to proteinuria-related renal tubular cell injury. PMID: 28628921
  9. mPGES-1 overexpression prevents Fas-induced hepatocyte apoptosis and liver injury through activation of Akt. PMID: 27102561
  10. The expression of Lcn2 and mPGES-1 is strongly stimulated by lipopolysaccharide (LPS), indicating that Lcn2 mediates LPS-induced inflammation. These findings shed light on the role of Lcn2 during decidualization. PMID: 27416888
  11. The results indicate that mPges-1 may be a direct downstream target gene of the P4 receptor. PMID: 27174800
  12. mPges-1 depletion modestly increased thrombogenesis in LDL-receptor knockout mice. This response was markedly further augmented by coincident deletion of the I prostanoid receptor. PMID: 27440004
  13. Data (including data from studies in knockout mice) suggests interactions of cholinergic/prostaglandin systems participate in neuroimmunomodulation; microsomal Ptges-1 is part of the cholinergic anti-inflammatory response in chronic inflammatory diseases. PMID: 26001880
  14. Prostacyclin synthase and prostaglandin E synthase-1 cooperatively exacerbate inflammatory reactions but have opposing effects on carcinogenesis. PMID: 26611322
  15. Gas6, through upregulation of Ptges/PGE2, contributes to cancer-induced venous thrombosis. PMID: 26585956
  16. Vascular mPGES-1 plays a protective role in blood vessels and attenuates rupture of cerebral aneurysms. PMID: 26134597
  17. Suggest a pivotal role of the COX-2-mPGES-1-PGE2 axis in vascular calcification. Inhibition of COX-2 or mPGES-1 may increase the risk of calcification and subsequent adverse cardiovascular events during chronic renal failure. PMID: 26543101
  18. The present results suggest that mPGES-1 plays a significant role in lymphangiogenesis during inflammation, and represents a novel target for controlling IL. PMID: 26459051
  19. Data suggests that an as yet unidentified prostaglanind E synthase, but not mPGES-1, may couple with COX-2 to mediate increased renal PGE2 synthesis in DN. PMID: 24984018
  20. This study demonstrates that mPGES-1 is expressed in the mouse brain, both in vascular endothelial cells, in several other cellular of capillary associated pericytes, astrocytes, and cells in circumventricular organs, choroid plexus, and leptomeninges. PMID: 24668417
  21. mPGES-1 deficiency exacerbates bleomycin-induced pulmonary fibrosis. PMID: 24756129
  22. mPGES-1 appears to be critical for tumor metastasis in prostate cancers. PMID: 24291175
  23. Melatonin modulates microsomal PGE synthase 1 and NF-E2-related factor-2-regulated antioxidant enzyme expression in LPS-induced murine peritoneal macrophages. PMID: 24116971
  24. Genetic deletion of mPGES-1 affects eicosanoid profiles in LPS-induced mouse peritoneal macrophages. PMID: 23916744
  25. Genetic ablation improves survival against lethal influenza A infection. PMID: 24726877
  26. mPGES-1 contributes to mammary tumor growth. PMID: 23624019
  27. In contrast to exaggeration of the response to vascular injury, deletion of mPGES-1 in vascular smooth muscle cells, endothelial cells, or both had no detectable phenotypic impact on atherogenesis. PMID: 24753592
  28. mPGES-1 and its product PGE2 are important negative regulators of neutrophil-mediated arthritis inflammation. PMID: 24055573
  29. PGE2 is a key regulator of white-to-brown adipogenesis; there may be coordinate regulation of adipogenesis between PPARgamma and mPGES-1. PMID: 23943621
  30. Results suggest that central PGE(2) derived from non-neuronal mPGES-1 aggravates the disruption of the vessel structure, leading to the spread of inflammation and local demyelination in the spinal cord, which corresponds to the symptoms of EAE. PMID: 23266396
  31. Activation of mPGES-1 is involved in the rapid and vital response to severe hypoxia as well as inflammation. PMID: 22926547
  32. Deletion of mPGES-1 in the vasculature and myeloid cells differentially modulates the response to vascular injury, implicating macrophage mPGES-1 as a cardiovascular drug target. PMID: 23204105
  33. Results indicate that PGE(2) was synthesized by PTGES1 in adipocytes and synergistically suppressed the early phase of adipogenesis of 3T3-L1 cells in cooperation with PGF(2alpha) through receptor-mediated activation of PTGS2 expression. PMID: 22970288
  34. These results suggest that mPGES-1-derived PGE(2) contributes to dehydration natriuresis likely via NO/cGMP. PMID: 23171554
  35. PGE2 produced by microsomal PGES-1 regulates the onset of wakefulness and the maintenance of circadian rhythm. PMID: 21784115
  36. Cyclooxygenase-2, not microsomal prostaglandin E synthase-1, is the mechanism for interleukin-1beta-induced prostaglandin E2 production and inhibition of insulin secretion in pancreatic islets. PMID: 22822059
  37. These results indicated that mPGES-1 is induced during Abeta-mediated neuronal cell death and is involved in Abeta-induced neurotoxicity associated with Alzheimer's disease pathology. PMID: 22766501
  38. A tight cooperation between the EGF/EGFR and mPGES-1 leads to a significant tumorigenic gain in epithelial cells. PMID: 22081067
  39. mPGES-1 upregulation upon lactational TCDD exposure is a causal factor for TCDD-induced hydronephrosis in mouse neonates. PMID: 22430074
  40. It was shown that microsomal prostaglandin E synthase 1 is involved in multiple steps of early to late stages of carcinogenesis, likely by altering the balance of pro- and antitumorigenic lipid mediators and thereby several signaling pathways. PMID: 21986945
  41. Lack of mPGES-1 in bone marrow-derived leukocytes negatively regulates COX-1 expression, PGE2 biosynthesis, and inflammation in myocardial infarct and leads to impaired left ventricle function, adverse LV remodeling, and decreased survival. PMID: 22589381
  42. Imidazoquinolines represent a novel structural class of microsomal prostaglandin E synthase-1 inhibitors. PMID: 22137787
  43. The results suggest that mPGES-1 in motor neurons may play a role in the pathogenesis of ALS; mPGES-1 may work sequentially in motor neurons and activated microglia to produce ALS symptoms in G93A mice. PMID: 22302024
  44. The results suggested that mPGES-1-derived PGE2 reduces urine concentrating ability through suppression of renal medullary expression of V2 receptors and aquaporin 2 but may enhance it by mediating the central arginine vasopressin response. PMID: 22237797
  45. The study demonstrates that activation of PKA/CREB signaling through the EP2 receptor by PGE2 plays a key role in the expression of COX-2 and mPGES-1 in activated macrophages. PMID: 22268508
  46. We conclude that mPGES-1 deletion ameliorates chronic renal failure in the mouse model of renal mass reduction, and mPGES-1 deletion paradoxically exacerbates anemia in this model likely via suppression of erythropoietin synthesis. PMID: 22106404
  47. Cigarette smoke, in association with cytokines, alters the balance between prostacyclin and prostaglandin E2, reducing prostacyclin production and increasing synthesis and activity of mPGES-1 via NADPH-oxidase activation. PMID: 21737615
  48. mPGES-1 expression is required for bleomycin-induced skin fibrogenesis. PMID: 21266028
  49. mPGES-1 knockout mice were used to evaluate the immunoregulatory effects associated with the genetic deletion of mPGES-1 in dendritic cells. PMID: 21190819
  50. It was found that endothelial mPGES-1 produced PGE(2) that enhanced astrocytic Ca(2+) levels via EP3 receptors and increased Ca(2+)-dependent glutamate release, aggravating neuronal injury. PMID: 21219953

Show More

Hide All

Database Links
Protein Families
MAPEG family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is the functional role of Ptges in mouse models?

Ptges functions as a glutathione-dependent prostaglandin E synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to prostaglandin E2 (PGE2) in the prostaglandin biosynthetic pathway . This terminal enzyme in the cyclooxygenase (COX)-2-mediated PGE2 biosynthesis is critical for inflammatory responses, as it is induced by proinflammatory cytokines such as interleukin-1β (IL-1β) . In mouse models, Ptges plays key roles in:

  • Mediating acute pain during inflammatory responses

  • Contributing to the pathogenesis of collagen-induced arthritis

  • Regulating inflammatory responses in various tissues

  • Participating in tumor progression mechanisms, particularly in immunosuppression

Knockout studies in mice have provided substantial evidence that Ptges contributes significantly to inflammatory disease pathogenesis and pain signaling pathways . Beyond its primary enzymatic function, Ptges also displays glutathione transferase and glutathione-dependent peroxidase activities, though at relatively lower levels compared to its prostaglandin synthase activity .

How does mouse Ptges expression change during inflammatory conditions?

Mouse Ptges expression is dynamically regulated during inflammatory conditions. The gene is robustly induced by proinflammatory stimuli, particularly by the cytokine interleukin-1β (IL-1β) . Additionally, the tumor suppressor protein p53 (TP53) can induce Ptges expression, suggesting a potential role in stress responses and apoptotic pathways .

In inflammatory microenvironments:

  • Basal expression is typically low in most tissues under normal physiological conditions

  • Rapid upregulation occurs following exposure to inflammatory stimuli

  • Expression patterns vary across different tissue types, with particularly notable expression in immune cells, lung tissue, and gastrointestinal tissues

  • The kinetics of expression typically correlate with the inflammatory response timeline

During cell death processes (including necrosis, pyroptosis, and apoptosis), Ptges-derived PGE2 is released and functions as a damage-associated molecular pattern (DAMP) that helps regulate inflammatory responses . This represents a significant negative feedback mechanism that prevents excessive inflammation following tissue damage.

What detection methods are most reliable for measuring mouse Ptges protein and activity?

For accurate detection and quantification of mouse Ptges protein and enzymatic activity, researchers should consider these validated methodologies:

MethodApplicationAdvantagesLimitations
Western blottingProtein detectionGood for relative quantificationLimited quantitative accuracy
qRT-PCRmRNA expressionHigh sensitivity, good for temporal studiesDoes not measure protein or activity
Enzyme activity assayFunctional analysisDirect measurement of catalytic activityRequires careful sample preparation
Mass spectrometryPrecise quantificationHighly accurate measurement of protein/metabolitesComplex methodology, expensive
ImmunohistochemistryTissue localizationPreserves spatial informationSemi-quantitative at best

For most reliable results, activity assays should measure the conversion of PGH2 to PGE2 using purified recombinant enzyme or tissue lysates under controlled conditions . The addition of glutathione as a cofactor is essential for optimal enzymatic activity assessment. PGE2 production can be quantified using enzyme immunoassay (EIA) or liquid chromatography-mass spectrometry (LC-MS) methods.

What are the optimal conditions for expressing and purifying recombinant mouse Ptges?

Successful expression and purification of functional recombinant mouse Ptges requires careful optimization of several parameters:

Expression Systems:

  • Bacterial systems (E. coli): While cost-effective, may yield lower activity due to lack of post-translational modifications

  • Mammalian cells (HEK293, CHO): Provide proper folding and modifications but at higher cost

  • Insect cell systems (Sf9, High Five): Often the preferred compromise between yield and functionality

Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction timing: Induce at mid-log phase (OD600 ~0.6-0.8) for bacterial systems

  • Expression duration: 16-24 hours typically yields optimal balance between quantity and quality

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

  • Intermediate purification: Ion exchange chromatography to remove contaminants

  • Polishing: Size exclusion chromatography for highest purity

Critical Factors for Maintaining Activity:

  • Include glutathione in all buffers during purification (1-5 mM)

  • Avoid freeze-thaw cycles; store purified protein with 10-20% glycerol

  • Use mild detergents (0.05-0.1% Triton X-100) to maintain protein solubility as Ptges is a membrane-associated protein

  • Maintain pH between 7.2-8.0 throughout the purification process

Post-purification validation should include SDS-PAGE, Western blotting, and enzyme activity assays to confirm both purity and functionality of the recombinant protein .

How can I design effective Ptges knockout and knockdown studies in mouse models?

Designing effective Ptges knockout and knockdown studies requires consideration of several key factors to ensure meaningful results:

Knockout Strategies:

  • Global knockout approach:

    • Targeted deletion of Ptges exons (typically exons containing catalytic domains)

    • Phenotype assessment across multiple systems (inflammatory, cardiovascular, renal)

    • Consider embryonic lethality issues that may necessitate conditional approaches

  • Conditional knockout design:

    • Use Cre-loxP system for tissue-specific or inducible deletion

    • Target tissues with high Ptges expression (macrophages, lung, kidney)

    • Implement tamoxifen-inducible systems for temporal control

  • Knockdown approaches:

    • siRNA delivery via various carriers (lipid nanoparticles, viral vectors)

    • shRNA expression for longer-term suppression

    • Consider tissue-specific promoters for targeted expression

Critical Controls:

  • Include littermate controls from heterozygous breeding

  • Validate knockout efficiency at both mRNA and protein levels

  • Assess potential compensatory upregulation of related enzymes (mPGES-2, cPGES)

  • Measure PGE2 levels to confirm functional impact of knockout

Phenotyping Parameters:

ModelPrimary EndpointsSecondary EndpointsChallenges
Inflammation modelsEdema measurement, pain behavior, cytokine levelsImmune cell infiltration, histopathologyCompensatory mechanisms
Cancer modelsTumor growth, metastasis, survivalImmune infiltration, angiogenesisTumor heterogeneity
Metabolic modelsWeight, glucose toleranceEnergy expenditure, food intakeEnvironmental variables

When designing knockout studies, researchers should be aware that Ptges knockout in cancer models may still permit tumor formation in immunodeficient mice while preventing it in immunocompetent animals, highlighting the importance of immune system consideration in experimental design .

What are the validated methods for measuring PGE2 production in Ptges experimental systems?

Accurate measurement of PGE2 production is critical for evaluating Ptges function in experimental systems. The following validated methods can be employed:

Enzyme Immunoassay (EIA)/ELISA:

  • Most commonly used method for routine PGE2 quantification

  • Commercially available kits offer convenience and standardization

  • Sensitivity typically in the pg/ml range

  • Requires careful sample collection with COX inhibitors to prevent ex vivo synthesis

Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

  • Gold standard for absolute quantification and specificity

  • Can simultaneously measure multiple prostanoids

  • Allows distinction between closely related prostaglandin species

  • Requires specialized equipment and expertise

Radioimmunoassay (RIA):

  • Historically used but largely replaced by EIA/ELISA

  • Still useful for certain applications requiring highest sensitivity

Sample Collection Considerations:

  • Collect samples in the presence of COX inhibitors (indomethacin) to prevent artifactual production

  • Process samples rapidly and maintain cold chain

  • Use appropriate anticoagulants for blood samples (EDTA preferred)

  • Consider the half-life of PGE2 (minutes) when designing collection protocols

Experimental Design Factors:

  • Include both baseline and stimulated conditions (LPS, IL-1β) to assess dynamic range

  • Compare PGE2 production in wildtype versus Ptges knockout/knockdown systems

  • Correlate PGE2 levels with biological outcomes (inflammation markers, phenotypic changes)

  • Consider the influence of culture conditions on PGE2 stability

When analyzing PGE2 production in cell death contexts, it's important to note that PGE2 is released during various forms of cell death, including necrosis, pyroptosis (ATP/LPS-induced), and apoptosis (cisplatin/etoposide-induced) .

How does Ptges contribute to immunosuppression mechanisms in cancer models?

Ptges plays a critical role in tumor-associated immunosuppression, particularly through its production of PGE2. Recent research has revealed several key mechanisms:

Direct Effects on Immune Cell Function:

  • PGE2 derived from Ptges activity directly inhibits T cell proliferation and cytotoxicity

  • Promotes T regulatory cell differentiation and function

  • Suppresses NK cell activities and cytokine production

  • Alters dendritic cell maturation and antigen presentation

Myeloid-Derived Suppressor Cell (MDSC) Recruitment:
Critical research in Gprc5a-knockout mouse models has demonstrated that Ptges/PGE2 signaling induces cytokines that recruit MDSCs to the tumor microenvironment . These MDSCs are crucial mediators of immunosuppression that:

  • Directly inhibit T-cell functions

  • Produce immunosuppressive cytokines

  • Deplete essential amino acids from the tumor microenvironment

  • Create oxidative stress that impairs immune effector cells

Tumor Cell Intrinsic Resistance:
Ptges/PGE2 signaling intrinsically endows tumor cells with resistance to T-cell cytotoxicity . This protective effect involves:

  • Upregulation of anti-apoptotic proteins

  • Modulation of checkpoint molecule expression

  • Alteration of tumor cell metabolism

Therapeutic Implications:
Targeting Ptges in mouse tumor models shows significant promise, as PTGES inhibitors have been shown to:

  • Suppress MDSC recruitment

  • Restore T cell functions

  • Significantly repress lung metastasis in Gprc5a-knockout mice

This research indicates that Ptges represents a critical link between inflammation, immunosuppression, and metastasis in the tumor microenvironment. Notably, Ptges-knockout tumor cells still form tumors in immunodeficient mice but fail to do so in immunocompetent animals, confirming that the primary role of Ptges in tumorigenicity operates through immune evasion mechanisms .

What is the relationship between Ptges and cellular stress responses?

Ptges functions at the intersection of cellular stress responses and inflammatory signaling, with several important relationships emerging from recent research:

p53-Mediated Regulation:

  • The tumor suppressor p53 (TP53) can induce Ptges expression

  • This suggests Ptges may participate in cellular responses to genotoxic stress

  • Ptges induction may contribute to p53-mediated apoptosis through PGE2 production

Role in Cell Death-Associated Inflammation:
PGE2 produced by Ptges serves as a damage-associated molecular pattern (DAMP) released by dying cells . This PGE2 release:

  • Occurs during multiple forms of cell death (necrosis, pyroptosis, apoptosis)

  • Negatively regulates cell death-induced inflammatory responses

  • Helps prevent excessive inflammation following tissue damage

  • Creates a feedback loop that modulates immune responses to dying cells

Oxidative Stress Interactions:

  • Ptges possesses glutathione-dependent peroxidase activity toward certain substrates like 5-hydroperoxyicosatetraenoic acid (5-HPETE)

  • This suggests a potential role in managing oxidative stress products

  • The glutathione requirement for Ptges activity creates a link to cellular redox status

ER Stress Connection:

  • Emerging evidence suggests connections between ER stress pathways and Ptges regulation

  • The unfolded protein response (UPR) may influence Ptges expression

  • This relationship may be particularly relevant in diseases with prominent ER stress components

Understanding these relationships is crucial for researchers investigating Ptges in the context of cancer, inflammatory diseases, and cellular adaptation to stress. The multifaceted role of Ptges in stress responses highlights its potential as a therapeutic target in conditions characterized by dysregulated stress response pathways.

How do Ptges inhibitors affect different inflammatory disease models?

Ptges inhibitors demonstrate variable efficacy across different inflammatory disease models, reflecting the context-dependent roles of this enzyme. Here's a comparative analysis of effects in major disease models:

Disease ModelPtges Inhibitor EffectsBiomarkers AffectedComparative Efficacy
Rheumatoid ArthritisReduced joint inflammation, cartilage degradation↓ IL-6, TNF-α, MMP expressionSuperior to COX-2 inhibitors for GI safety
Lung InflammationDecreased neutrophil infiltration, cytokine production↓ IL-8, IL-1β, neutrophil elastaseComparable to corticosteroids
Cancer (immunocompetent models)Suppressed metastasis, enhanced anti-tumor immunity↑ CD8+ T cells, ↓ MDSCs, ↓ M2 macrophagesSuperior to COX inhibitors for immune effects
NeuroinflammationReduced microglial activation, neuroprotection↓ iNOS, ↓ microglial activation markersModerate effects compared to other approaches
Inflammatory Bowel DiseaseVariable effects depending on disease stageMixed cytokine profile changesLess consistent than in other models

Key mechanistic differences to consider:

  • Timing-dependent effects: Early inhibition often shows greater benefit than delayed intervention

  • Cell-type specific responses: Effects vary based on which cells predominantly express Ptges in each model

  • Compensatory mechanisms: Alternative prostaglandin production pathways may become activated

  • Disease stage influence: Acute versus chronic inflammation models show different responses

In cancer models specifically, Ptges inhibitors show remarkable efficacy in suppressing MDSC recruitment, restoring T cell function, and significantly repressing metastasis . This indicates that targeting the Ptges/PGE2 axis is particularly valuable in conditions where immunosuppression plays a central role in disease pathogenesis.

Researchers should carefully consider these model-specific responses when designing studies with Ptges inhibitors and interpret findings in the context of the particular inflammatory mechanism being investigated.

How should researchers interpret conflicting data regarding Ptges function across different experimental systems?

When faced with conflicting data about Ptges function, researchers should implement a systematic approach to analysis and interpretation:

Source of Variability Assessment:

  • Species differences:

    • Mouse Ptges may have subtle functional differences from human PTGES

    • Evolutionary conservation analysis should precede cross-species comparisons

    • Consider using humanized mouse models for translational studies

  • Genetic background effects:

    • Different mouse strains show variable inflammatory responses

    • Document complete genetic background information in all studies

    • Use littermate controls and backcrossing to minimize background effects

  • Methodological considerations:

    • Expression systems impact protein folding and post-translational modifications

    • Assay sensitivity and specificity vary considerably between laboratories

    • Standardize methodologies when comparing across studies

Resolution Framework for Conflicting Data:

  • Contextual analysis:

    • Evaluate whether differences reflect context-dependent roles rather than contradictions

    • Consider tissue-specific effects and microenvironmental factors

    • Assess the impact of disease stage on observed phenotypes

  • Dose-response relationships:

    • Biphasic effects may explain apparent contradictions

    • Determine whether threshold effects exist for Ptges activity

    • Quantify enzyme activity alongside expression levels

  • Temporal considerations:

    • Early vs. late effects may differ substantially

    • Acute vs. chronic models often yield different results

    • Time-course experiments are essential for resolving temporal conflicts

A notable example is seen in cancer research, where Ptges knockout in mouse lung tumor cells results in different outcomes depending on the immune status of the host: tumors still form in immune-deficient nude mice but not in immune-competent mice . This apparently conflicting result actually reveals the immunomodulatory mechanism of Ptges in cancer, highlighting how apparent contradictions can lead to mechanistic insights when properly analyzed.

What are the best approaches for analyzing Ptges expression in heterogeneous tissue samples?

Analyzing Ptges expression in heterogeneous tissue samples presents unique challenges that require specialized approaches:

Single-Cell and Spatial Technologies:

  • Single-cell RNA sequencing (scRNA-seq):

    • Resolves cell-type specific expression patterns

    • Identifies rare cell populations with high Ptges expression

    • Reveals cellular heterogeneity masked in bulk analysis

  • Spatial transcriptomics:

    • Preserves spatial information about Ptges expression

    • Maps expression to specific tissue microenvironments

    • Correlates with histological features

  • Multiplex immunofluorescence:

    • Simultaneously detects Ptges and cell type markers

    • Quantifies protein at the single-cell level

    • Allows correlation with morphological features

Computational Deconvolution Approaches:

For bulk RNA-seq or microarray data from heterogeneous samples, computational deconvolution can estimate cell-type specific contributions:

MethodPrincipleAdvantagesLimitations
CIBERSORTSupport vector regressionWell-validated, robustRequires reference profiles
MuSiCMulti-subject deconvolutionHandles batch effects wellComputationally intensive
CIBERSORTxExtended CIBERSORTEnables cross-platform analysisComplex implementation
DeconRNASeqNon-negative matrix factorizationSimple implementationLess accurate for rare populations

Statistical Considerations:

  • Apply appropriate normalization methods for heterogeneous samples

  • Incorporate mixed-effects models to account for within-sample correlation

  • Use bootstrapping approaches to estimate confidence intervals

  • Consider batch effects and technical variables in study design

When analyzing Ptges expression in tissue samples, it's particularly important to consider immune cell infiltration, as these cells often express high levels of Ptges upon activation . The relative proportion of immune cells in a sample can dramatically affect bulk expression measurements and lead to misinterpretation if not properly accounted for.

How can researchers differentiate between direct Ptges-mediated effects and secondary pathway activation?

Distinguishing direct Ptges-mediated effects from secondary pathway activation requires sophisticated experimental approaches and careful analysis:

Mechanistic Dissection Strategies:

  • Genetic rescue experiments:

    • Reintroduce wild-type or catalytically inactive Ptges into knockout backgrounds

    • Compare phenotypic rescue with enzyme activity restoration

    • Use domain-specific mutants to identify structure-function relationships

  • Temporal inhibition studies:

    • Apply Ptges inhibitors at different time points during response

    • Use inducible knockout systems for temporal control

    • Correlate immediate versus delayed effects with pathway activation timelines

  • Direct target identification:

    • Perform receptor antagonist studies to block PGE2 signaling

    • Use specific EP receptor (EP1-4) antagonists to identify receptor dependencies

    • Measure immediate downstream mediators (cAMP, Ca2+ mobilization) as proximal readouts

Pathway Analysis Framework:

ApproachApplicationStrengthsLimitations
Phosphoproteomic profilingMaps signaling cascadesComprehensive, quantitativeExpensive, technically challenging
Transcriptome analysis with time courseIdentifies expression wavesGenome-wide viewCannot distinguish direct from indirect targets
Metabolomic profilingIdentifies metabolic shiftsCaptures functional outcomesComplex data interpretation
In silico network analysisPredicts pathway connectionsHypothesis generatingRequires validation

Critical Controls:

  • Pharmacological validation:

    • Compare genetic knockout with selective inhibitors

    • Use structurally distinct inhibitors to confirm target specificity

    • Include appropriate vehicle controls

  • Dose-response relationships:

    • Establish quantitative relationships between Ptges activity and observed effects

    • Correlate PGE2 levels with biological outcomes

  • Cross-species validation:

    • Confirm effects in multiple model systems

    • Leverage evolutionary conservation to identify core pathways

A concrete example comes from research on the immunosuppressive role of Ptges in cancer, where studies demonstrated that Ptges/PGE2 signaling exerts effects through two distinct mechanisms: intrinsically making tumor cells resistant to T-cell cytotoxicity and extrinsically inducing cytokines for MDSC recruitment . This two-pronged mechanism was elucidated through careful experimental design that distinguished between tumor cell-autonomous effects and impacts on the immune microenvironment.

What are the emerging roles of Ptges in metabolic regulation and disease?

Recent research has uncovered several novel roles for Ptges in metabolic regulation, expanding our understanding beyond its classical inflammatory functions:

Adipose Tissue Biology:

  • Ptges expression in adipose tissue responds to nutritional status and inflammatory stimuli

  • PGE2 production influences adipocyte differentiation and function

  • Preliminary evidence suggests Ptges may regulate thermogenic programs in brown and beige adipose tissue

Hepatic Metabolism:

  • Liver-specific Ptges activity affects glucose homeostasis through multiple mechanisms

  • PGE2 signaling modulates hepatic insulin sensitivity and glycogen metabolism

  • Increasing evidence connects Ptges to lipid metabolism and fatty liver disease progression

Pancreatic Function:

  • Ptges-derived PGE2 influences insulin secretion from pancreatic β-cells

  • Inflammatory activation of Ptges may contribute to β-cell dysfunction in diabetes

  • Emerging research suggests roles in α-cell function and glucagon secretion

Energy Expenditure Regulation:

  • Central nervous system effects of PGE2 influence feeding behavior and energy expenditure

  • Fever generation through hypothalamic PGE2 represents a significant energy-consuming process

  • Skeletal muscle energy utilization may be modulated by local Ptges activity

Metabolic Inflammation Interface:
The most compelling emerging role for Ptges lies at the intersection of inflammation and metabolism, where it appears to serve as a key mediator translating inflammatory signals into metabolic adaptations. This is particularly relevant in conditions characterized by meta-inflammation, such as obesity and type 2 diabetes.

These emerging functions suggest that Ptges inhibitors may have therapeutic potential beyond inflammatory conditions, potentially extending to metabolic disorders. Future research directions should include tissue-specific knockout studies focusing on metabolic tissues and detailed characterization of the metabolic phenotypes resulting from Ptges modulation.

How is Ptges involved in regulating cell death pathways and tissue repair?

Ptges plays sophisticated roles in both cell death regulation and subsequent tissue repair processes:

Cell Death Regulation:

Recent research has revealed that Ptges-derived PGE2 functions as a damage-associated molecular pattern (DAMP) released by dying cells . This release occurs during multiple forms of cell death:

  • Necrosis

  • Pyroptosis (ATP/LPS-induced)

  • Apoptosis (cisplatin/etoposide-induced)

The released PGE2 serves as a negative regulator of cell death-induced inflammatory responses , creating a feedback mechanism that prevents excessive inflammation following tissue damage.

Additionally, Ptges expression can be induced by the tumor suppressor protein p53 (TP53) and may be involved in p53-induced apoptosis , suggesting a complex relationship with programmed cell death pathways.

Tissue Repair Mechanisms:

Following tissue damage, Ptges-derived PGE2 influences multiple phases of the repair process:

  • Inflammatory phase:

    • Modulates neutrophil and macrophage recruitment and function

    • Helps establish resolution timing through negative feedback

    • Regulates vascular permeability and edema formation

  • Proliferative phase:

    • Stimulates fibroblast proliferation and migration

    • Promotes angiogenesis through VEGF induction

    • Influences stem/progenitor cell behavior in multiple tissues

  • Remodeling phase:

    • Modulates extracellular matrix production and remodeling

    • Affects myofibroblast differentiation and function

    • Influences scar formation and tissue architecture restoration

Therapeutic Implications:

Understanding the dual roles of Ptges in cell death and repair suggests potential therapeutic strategies:

  • Temporal targeting of Ptges may allow modulation of specific repair phases

  • Tissue-specific Ptges inhibition could optimize repair while minimizing inflammation

  • Combined therapies targeting both Ptges and specific repair pathways may improve outcomes in chronic inflammatory conditions

These findings highlight the complex, context-dependent functions of Ptges across the cell death and tissue repair continuum, emphasizing the need for sophisticated experimental approaches to fully elucidate its roles in different tissues and disease states.

What are the most promising approaches for developing selective mouse Ptges inhibitors for research applications?

The development of selective mouse Ptges inhibitors for research applications has progressed significantly, with several approaches showing promise:

Structure-Based Design Strategies:

With advances in structural biology, rational design approaches have yielded several promising scaffold classes:

  • Indole derivatives:

    • Target the enzyme active site with high specificity

    • Show favorable pharmacokinetic properties in mouse models

    • Several compounds demonstrate nanomolar potency

  • Phenanthrene imidazoles:

    • Bind allosterically to modify enzyme conformation

    • Demonstrate selectivity over related enzymes

    • Show good brain penetration for CNS studies

  • Modified carbazoles:

    • Interact with both the active site and membrane-binding domains

    • Exhibit prolonged tissue retention in mouse models

    • Reduced off-target effects compared to earlier inhibitors

Comparative Inhibitor Profiles:

Inhibitor ClassPotency (IC50)SelectivityIn vivo Half-lifeSpecial Features
Indole derivatives5-50 nM>100x vs. COX4-8 hoursOral bioavailability
Phenanthrene imidazoles20-200 nM>50x vs. mPGES-26-12 hoursBrain penetration
Modified carbazoles10-100 nM>80x vs. related enzymes3-6 hoursLow toxicity profile
Covalent inhibitors1-10 nMVariableVariableProlonged inhibition

Validation Approaches:

To ensure research utility, comprehensive validation is essential:

  • In vitro validation:

    • Enzymatic assays with recombinant protein

    • Cell-based activity measurements

    • Selectivity profiling against related enzymes

  • Ex vivo assessments:

    • Tissue explant studies for efficacy verification

    • Microsomal stability testing

    • Protein binding determinations

  • In vivo confirmation:

    • PK/PD relationship establishment

    • Target engagement biomarkers

    • Efficacy in disease models compared to genetic knockout

Current evidence suggests that selective Ptges inhibitors show particular promise in cancer models, where they can suppress MDSC recruitment, restore T cell function, and significantly repress metastasis . This application highlights the potential of these research tools for investigating immunomodulatory mechanisms.

For researchers developing or using these inhibitors, it's critical to remember that compensatory mechanisms may emerge in chronic dosing paradigms, necessitating careful experimental design and interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.