Recombinant Mouse Prostaglandin E2 receptor EP2 subtype (Ptger2)

Shipped with Ice Packs
In Stock

Description

Introduction to Prostaglandin E2 Receptor EP2 Subtype

Prostaglandin E2 receptor EP2 subtype, encoded by the Ptger2 gene, belongs to the family of prostanoid receptors that respond to prostaglandin E2, an important lipid mediator derived from arachidonic acid metabolism . The receptor functions as a G-protein coupled receptor, characterized by seven transmembrane domains and coupling to stimulatory G proteins (Gs) . Mouse Ptger2 was first identified and cloned in 1994 by Taketo and colleagues, alongside the EP3 receptor subtype, marking a significant advancement in understanding prostaglandin receptor diversity .

The EP2 receptor represents one of four identified EP receptors (EP1, EP2, EP3, and EP4) that bind prostaglandin E2 with varying affinities and trigger distinct cellular responses . Among these receptors, EP2 is classified as a "relaxant" type of prostanoid receptor based on its ability to relax certain types of smooth muscle when activated . This classification reflects its physiological role in mediating vasodilation, bronchodilation, and other relaxatory responses throughout the body.

Unlike most G-protein coupled receptors, EP2 possesses the remarkable property of resistance to homologous desensitization, allowing for sustained signaling over prolonged periods . This characteristic distinguishes EP2 from other prostaglandin receptors and contributes to its involvement in chronic phases of cellular and tissue responses rather than transient adaptations.

Tissue Distribution and Expression Regulation

Mouse EP2 receptor demonstrates widespread tissue distribution, with expression detected in lung, spleen, intestine, skin, kidney, liver, long bones, and extensively throughout the brain and other regions of the central nervous system . This broad expression pattern underscores the receptor's involvement in multiple physiological processes across different organ systems.

Expression of EP2 receptors can be dynamically regulated under various physiological and pathological conditions. Studies have identified decreased EP2 expression in fibroblasts from models of pulmonary fibrosis, associated with hypermethylation of CpG dinucleotide sites in the promoter region . This epigenetic regulation suggests mechanisms for context-specific modulation of receptor levels, potentially contributing to disease pathogenesis.

Table 1: Comparison of Mouse and Human EP2 Receptor Properties

PropertyMouse EP2 (Ptger2)Human EP2 (PTGER2)
Amino Acid Length632 amino acids358 amino acids
Gene LocationNot specified in sourcesChromosome 14q22.1
G-protein CouplingGs proteinGs protein
DesensitizationResistantResistant
Key Signaling PathwayscAMP, GSK-3, β-catenincAMP, GSK-3, β-catenin

G-protein Coupled Signaling

When bound to prostaglandin E2, mouse EP2 receptor activates heterotrimeric G proteins containing the Gs alpha subunit (Gαs)-G beta-gamma complexes . These complexes subsequently dissociate into their Gαs and G βγ subunits, which then regulate multiple cell signaling pathways. The activated Gαs stimulates adenylyl cyclase to convert adenosine triphosphate (ATP) to cyclic adenosine monophosphate (cAMP), leading to activation of protein kinase A (PKA) .

PKA phosphorylates various signaling molecules including the transcription factor cAMP response element-binding protein (CREB), which regulates gene expression profiles essential for diverse cellular responses . The specific functional outcomes of this signaling cascade depend on the cell type and physiological context.

Alternative Signaling Pathways

Beyond the canonical cAMP pathway, EP2 activation influences additional signaling cascades with important cellular consequences. The receptor activates the glycogen synthase kinase-3 (GSK-3) pathway, which regulates cell migration and innate immune responses including pro-inflammatory cytokine and interleukin production .

EP2 signaling also impacts the β-catenin pathway, affecting not only cell-cell adhesion but also activating the Wnt signaling pathway . This activation stimulates the transcription of genes responsible for regulating cell migration and proliferation, with significant implications for developmental processes and disease conditions including cancer.

Resistance to Desensitization

A distinctive characteristic of mouse EP2 receptor, shared with its human counterpart, is its resistance to homologous desensitization . Most G-protein coupled receptors, including other prostaglandin receptors, undergo rapid agonist-induced desensitization, often becoming internalized and incapable of activating their G protein targets . This effect typically limits the duration and extent of cellular stimulation.

Reproductive System

Female mice genetically engineered to lack functional EP2 receptors demonstrate reproductive abnormalities, including modestly reduced ovulation and severely impaired fertilization capacity . These defects reflect the crucial role of EP2 in stimulating cumulus cell clusters surrounding oocytes to form the CCL7 chemokine, which serves as a chemoattractant guiding sperm cells to oocytes .

Additionally, EP2 signaling promotes disassembly of the extracellular matrix surrounding oocytes, facilitating sperm cell penetration and successful fertilization . These reproductive functions highlight the potential of EP2 receptor antagonists as contraceptive agents for women, offering a mechanism-based approach to fertility control.

Immune System Regulation

EP2 receptor signaling exerts significant immunomodulatory effects with important implications for both normal immune function and disease states. The receptor suppresses immune cell activities and promotes the development of regulatory T cells, which efficiently inhibit the immune system and suppress the activity of numerous immune cells, including dendritic cells .

Dendritic cells play a key role in initiating tumor-specific immune responses, and EP2 signaling not only blocks their activity but can also inhibit their generation . This leads to immunosuppression through myeloid-derived suppressor cells. Studies have demonstrated that knockout of EP2 receptors reduces tumor progression and prolongs survival in mice injected with cancer cells, associated with enhanced antitumor cytotoxic T-lymphocyte responses .

Angiogenesis

EP2 receptors promote angiogenesis in various contexts, including tumor development. Deletion of EP2 receptors downregulates the expression of angiogenic factors, including vascular endothelial growth factor (VEGF), and inhibits tumor angiogenesis . Beyond VEGF induction, EP2 signaling in endothelial cells regulates their activity and survival, directly promoting tumor angiogenesis in vivo .

Prostaglandin E2 signaling through EP2 triggers hyperplasia of the mammary gland and regulates VEGF induction in breast tumors in mice . Additionally, EP2 signaling directly regulates tumor angiogenesis and survival by enhancing epithelial cell activity, and can regulate hypertrophy and tumor invasion in response to ultraviolet stimulation .

Table 2: Functional Consequences of EP2 Receptor Activation in Various Systems

SystemEffect of EP2 ActivationPhysiological Outcome
ReproductiveStimulation of cumulus cellsEnhanced fertilization
ImmuneInhibition of dendritic cell functionImmunosuppression
VascularUpregulation of VEGFIncreased angiogenesis
OcularEnhanced aqueous humor drainageReduced intraocular pressure
CancerPromotion of tumor cell survivalAccelerated tumor growth
InflammatoryModulation of cytokine productionContext-dependent inflammatory responses

Production Methods

Recombinant Mouse Prostaglandin E2 receptor EP2 subtype refers to the artificially produced form of the receptor protein generated through recombinant DNA technology . This process typically involves cloning the mouse Ptger2 gene into expression vectors and introducing them into suitable host cells for protein production. Common expression systems include bacterial, yeast, insect, and mammalian cell lines, each offering different advantages regarding protein folding, post-translational modifications, and yield.

Commercial suppliers offer recombinant mouse EP2 receptor as a customized service, suggesting variations in production methods based on specific research requirements . The recombinant protein may include purification tags (e.g., histidine or glutathione S-transferase tags) and can be produced with different degrees of glycosylation depending on the expression system employed.

Quality control measures for recombinant mouse EP2 typically include verification of protein size and purity through sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), confirmation of identity through Western blotting or mass spectrometry, and functional testing through ligand binding or signaling assays .

Research Applications

Recombinant mouse EP2 receptor serves numerous research applications across basic science and translational investigations. It functions as a positive control in Western blotting and other immunoassays for detecting endogenous EP2 expression . The recombinant protein also serves as an immunogen for antibody production, facilitating the development of research tools for studying EP2 biology .

In drug discovery, recombinant mouse EP2 enables screening of potential therapeutic compounds targeting this receptor. It allows for high-throughput binding assays to identify novel ligands with agonist or antagonist properties. Structure-function studies using the recombinant protein help elucidate critical binding domains and inform rational drug design approaches.

The recombinant EP2 receptor also facilitates functional studies investigating signaling pathways, protein-protein interactions, and conformational changes associated with receptor activation. These insights contribute to understanding the molecular mechanisms underlying EP2's diverse physiological roles and pathological implications.

Table 3: Recombinant Mouse EP2 Products and Applications

Product TypeApplicationsReference
Recombinant ProteinPositive Control, Immunogen, SDS-PAGE, Western Blot
Antibodies against EP2Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation
ELISA KitsAntigen Detection
CLIA KitsCustomized Detection Services

Insights from Knockout Models

Studies utilizing mice genetically engineered to lack EP2 receptors have provided valuable insights into potential therapeutic applications. The reproductive defects observed in female EP2-knockout mice suggest that EP2 antagonists might serve as contraceptive agents, while EP2 agonists might assist in fertility treatments by enhancing fertilization efficiency .

In cancer research, the observed reduction in tumor progression and extended survival in EP2-knockout mice injected with cancer cells highlights the potential of EP2 antagonists as anti-cancer therapies . By reversing immunosuppression and inhibiting angiogenesis, such compounds might enhance anti-tumor immune responses and restrict tumor growth.

Therapeutic Potential

EP2's role in eye physiology, particularly in reducing intraocular pressure by enhancing aqueous humor drainage, points to potential applications in glaucoma treatment . This function has been observed across species including rodents, cats, monkeys, and humans, suggesting translational relevance from mouse models to human therapeutics.

In inflammatory conditions, the understanding of EP2 signaling derived from mouse models informs the development of targeted therapies. The receptor's resistance to desensitization makes it particularly relevant for chronic inflammatory disorders, where sustained signaling contributes to disease progression.

The dual role of EP2 in promoting both pro-inflammatory and anti-inflammatory effects depending on context suggests that selective modulation rather than complete inhibition might be advantageous for therapeutic interventions. This nuanced approach requires detailed understanding of EP2 signaling in specific disease contexts, highlighting the continued value of recombinant mouse EP2 in preclinical research.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. For precise delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol final concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ptger2; Ptgerep2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG QL
Uniprot No.

Target Background

Function
Prostaglandin E2 receptor EP2 (Ptger2) serves as a receptor for prostaglandin E2 (PGE2). Its activity is mediated by G(s) proteins, which stimulate adenylate cyclase. The resulting increase in intracellular cAMP is responsible for the receptor's relaxing effect on smooth muscle.
Gene References Into Functions
  1. In organotypic hippocampal slice cultures, inflammatory responses to Poly(I:C) or lipopolysaccharide (LPS) are primarily driven by TLR3 and TLR4, respectively, in a microglia-dependent manner. EP2 activation demonstrates diverse anti-inflammatory effects following Poly(I:C) and LPS challenge, potentially by inhibiting molecular pathways crucial in neurodegenerative diseases. PMID: 29226424
  2. The EP2 receptor provides protection against TGF-beta1-induced podocyte injury through the PI3K/Akt signaling pathway. PMID: 29746568
  3. EP2 contributes to generating mechanical hyperalgesia through positive feedback upregulation of COX-2 expression in muscle after lengthening contractions. PMID: 28759126
  4. Activation of the neuronal EP2 receptor by PGE2 protects the brain against intracerebral hemorrhage injury in middle-aged mice through its anti-inflammatory and anti-oxidant effects, as well as anti-MMP-2/9 activity. PMID: 26746866
  5. Data demonstrate that endogenous PGE2, EP2 receptors, and EPAC are essential for maximal LPS-induced IL-33 expression. Exogenous PGE2 can amplify IL-33 production via EP2 and EP4 receptors. PMID: 28341741
  6. The data highlight a key role for EP2 and EP4 receptors in microvascular leak induced by PGE2. PMID: 26639895
  7. EP2 deficiency in mast cells (MCs) augmented TGF-beta1-induced fibronectin (FN), cyclooxygenase-2 (COX2), and CyclinD1 expression. Silencing of EP2 also strengthened TGF-beta1-induced extracellular-signal-regulated kinase 1/2 (ERK1/2) phosphorylation. PMID: 26463992
  8. Autocrine prostaglandin E2 signaling through EP receptors is crucial for optimal CD4(+) T-cell activation. PMID: 26051593
  9. Blockade of EP2 and EP4 promotes mouse survival after cryptococcus infection by promoting cytokine production via TLR4 and enhancing M1 polarization of alveolar macrophages. PMID: 26122137
  10. The beneficial effect of both exogenous and endogenous PGE2 in aeroallergen-sensitized mice may be attributed to activation of the EP2 receptor, which acts as a restraint on airway MC activity. PMID: 25823713
  11. Cardiac inflammation is reduced in EP-2-/- mice. PMID: 26305786
  12. The study suggests a detrimental role for the PGE2-EP2 signaling axis in modulating brain injury, inflammation, and functional recovery following intracerebral hemorrhage. PMID: 25873308
  13. PGE2 is identified as the primary prostaglandin involved in neurovascular coupling, with pyramidal neurons as the main cellular source. PMID: 26311764
  14. This study's main finding is that PGE2 EP2-/- neurons are more susceptible to hemin neurotoxicity than wild-type neurons. Activation of the EP2 receptor protects neurons from hemin neurotoxicity. PMID: 25451967
  15. Further clarification is needed regarding which EP and/or FP receptor signals are physiologically essential for myometrial contraction and successful parturition. PMID: 25480981
  16. Regulation of CD36-mediated Abeta phagocytosis by suppression of EP2 signaling may offer a novel approach to mitigating certain aspects of Alzheimer disease pathogenesis. PMID: 25452117
  17. Data indicate that prostaglandin E2 receptor EP2-silencing RNA significantly enhances mesangial cell (MCs) proliferation. PMID: 25327961
  18. These results suggest that EP2 activation, initially promoting microglial activation, later causes delayed death of activated microglia, potentially contributing to the resolution phase of neuroinflammation. PMID: 25715797
  19. PGE2 -EP receptor signaling plays multiple roles in vascular permeability. PMID: 24923772
  20. The prostaglandin E2/E-prostanoid receptor 4 pathway plays a key role in activating renal CD44+ mesenchymal stromal cell-like cells during juxtaglomerular recruitment. PMID: 25776075
  21. Activation of the COX-2-PGE2-EP2 axis appears to be a specific response to fluid flow shear stress in podocytes and provides a mechanistic basis for alterations in podocyte structure and the glomerular filtration barrier. PMID: 25234310
  22. RORgammat directly binds to Ptger2 (the gene encoding EP2 receptor) in Th17 cells. PMID: 24812667
  23. Elastogenesis is spatially regulated by PGE-EP4 signaling in the ductus arteriosus. PMID: 24146253
  24. Prostaglandin E2 suppresses allergic sensitization and lung inflammation by targeting the EP2 receptor on T cells. PMID: 24075232
  25. PGE2 signaling by monocytes in the early preclinical phase promotes development of autoimmune encephalomyelitis in a prostanoid EP4 receptor-dependent manner. PMID: 24355567
  26. Data suggest that expression of Ptger2/Ptgs2 (prostaglandin-endoperoxide synthase 2) is induced in cumulus cells of females sired by males with Y-chromosome long-arm deletion; paternal genes on the Y-chromosome are indirectly involved in female reproduction. PMID: 22953728
  27. Fluid flow shear stress upregulates prostanoid receptor EP2 but not EP4 in murine podocytes. PMID: 23262148
  28. These data identify a cell-specific proinflammatory role for macrophage/microglial EP2 signaling in innate immune responses systemically and in the brain. PMID: 24089506
  29. PGE2 induces neuronal cell death by activation of EP2. PMID: 23514786
  30. EP2 deficiency in mice increases susceptibility to Mycobacterium tuberculosis infection, correlating with reduced antigen-specific T-cell responses and elevated levels of CD4(+)CD25(+)Foxp3(+) T-regulatory cells. PMID: 23033144
  31. Prostanoid receptor 2 signaling protects T helper 2 cells from BALB/c mice against activation-induced cell death. PMID: 22654101
  32. The data uncover a previously unknown protective role of PTGS-2-derived PGE(2) in streptozotocin-induced diabetes, mediated by PTGER2 and PTGER4. PMID: 22522619
  33. This supports a mechanism by which maturation and increased contractility of the vessel are coupled to the potent smooth muscle dilatory actions of PGE(2). PMID: 22342504
  34. Data show that E prostanoid receptor 2 (EP2)-deficient (EP2(-/-)) macrophages exhibit enhanced in vitro maturation compared to wild-type cells. PMID: 22234697
  35. This study's results suggest that PGE(2)-EP1 signaling is critical for susceptibility to repeated social defeat stress in mice, through attenuation of the mesocortical dopaminergic pathway. PMID: 22442093
  36. PGE2 suppresses natural killer functions in breast cancer-bearing hosts by acting on EP2 and EP4 receptors. PMID: 22306906
  37. COX-2-derived PGE(2) induces iNOS expression through cAMP/ERK pathways by activating EP(2) and EP(4) receptors in muscularis macrophages. PMID: 22159280
  38. HMW HA can rescue TNBS-induced colitis through inducing Cox-2 and PGE(2) expressions in a TLR4-dependent manner. PMID: 21887846
  39. Neointimal hyperplasia is markedly accelerated in EP2-/- mice, associated with increased proliferation and migration of vascular smooth muscle cells and increased cyclin D1 expression in the neointima layer. PMID: 21636806
  40. Unlike the PGE(2) receptors EP2 and EP4, the EP1 receptor acts as a negative regulator at multiple stages of the bone fracture healing process. PMID: 20939055
  41. EP2 receptor FuEP2/Ex2 may play a role in suppressing endometrial cancer cell growth. PMID: 21419570
  42. Upregulation of COX-2 and EP2 levels by CD40 engagement is accompanied by dose-dependent phosphorylation of p38 and ERK1/2 mitogen-activated protein kinase. PMID: 20697426
  43. Data demonstrate that down-regulation of PTGER2 and consequent PGE2 resistance are both mediated by DNA hypermethylation. Increased Akt signal transduction is a novel mechanism that promotes DNA hypermethylation during fibrogenesis. PMID: 20889571
  44. Data show a functional connection between PGE2 and beta-catenin nuclear translocation, connecting these signaling pathways as part of the mechanism by which bone cells respond to fluid flow shear stress. PMID: 20713195
  45. The prostaglandin E2 receptor, EP2, stimulates keratinocyte proliferation in mouse skin through G protein-dependent and β-arrestin1-dependent signaling pathways. PMID: 20959465
  46. Data show that donor engraftment is necessary for BMT-mediated reduction in age-related amyloid plaque formation in prostaglandin E2 receptor subtype 2-null mice, accompanied by reduced neurotoxic forms of amyloid peptides. PMID: 20522650
  47. Expression profiling of cumulus cells reveals functional changes during ovulation and central roles of the prostaglandin EP2 receptor in cAMP signaling. PMID: 20399827
  48. Data demonstrate that EP2 and EP4 function additively in EAE development. PMID: 20566843
  49. Local EP2 and EP4 agonist treatment induces VEGF synthesis in the inner ear, particularly in spiral ganglion neurons. This indicates the involvement of EP2 and EP4 in the autocrine and paracrine functions of VEGF in the cochlea. PMID: 20219142
  50. PGE2 receptor EP2 mediates the antagonistic effect of COX-2 on TGF-beta signaling during mammary tumorigenesis. PMID: 19897661

Show More

Hide All

Database Links

KEGG: mmu:19217

STRING: 10090.ENSMUSP00000038483

UniGene: Mm.4630

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and functional role of mouse Ptger2?

Mouse Prostaglandin E2 receptor EP2 subtype (Ptger2) is a 362 amino acid G protein-coupled receptor belonging to the prostanoid receptor family. It is characterized by seven transmembrane domains typical of GPCRs and functions primarily by coupling to Gs proteins, leading to adenylyl cyclase stimulation and increased intracellular cAMP levels . The principal endogenous ligand is PGE2, with PGE1 having similar potency, followed by PGF2α and PGI2, with the potency order being: PGE2 = PGE1 > PGF2α, PGI2 > PGD2, thromboxane A2 .

Ptger2 plays crucial roles in numerous physiological processes including inflammation, immune regulation, and cancer progression. In cancer contexts specifically, activation of Ptger2 can restrict the proliferative expansion and effector differentiation of TCF1+ CD8+ T cells, potentially promoting tumor immune escape . This receptor is therefore emerging as an important target for immunotherapeutic approaches in cancer treatment.

How does mouse Ptger2 differ from human PTGER2?

Mouse Ptger2 consists of the full 362 amino acids, while human PTGER2 comprises 358 amino acids . Despite this difference in length, they share high sequence homology, particularly in the transmembrane domains and intracellular loops involved in G protein coupling. The most notable structural differences occur in the N-terminal extracellular domain and the C-terminal region.

What signaling pathways are activated by mouse Ptger2?

Mouse Ptger2 activation primarily engages the Gs/adenylyl cyclase/cAMP/PKA pathway . Upon binding of PGE2, Ptger2 undergoes a conformational change that facilitates coupling to Gs proteins, which subsequently activate adenylyl cyclase to increase intracellular cAMP levels. This elevated cAMP then activates protein kinase A (PKA), leading to phosphorylation of various downstream targets including the cyclic AMP response element-binding protein (CREB) .

Phosphorylated CREB translocates to the nucleus where it regulates gene expression of multiple targets. In keratinocytes, this pathway promotes cell proliferation and cyclooxygenase-2 (COX-2) expression, establishing a positive feedback loop between PGE2 production and EP2 signaling . The PKA/CREB pathway is crucial for mediating many of the biological effects of EP2 activation in various cellular contexts.

In T cells specifically, EP2 signaling can modulate IL-2 responsiveness, affecting their proliferation and differentiation in the tumor microenvironment . This modulation appears to be a key mechanism by which tumor-derived PGE2 can suppress effector T cell functions and promote immune evasion.

What expression systems are optimal for producing functional recombinant mouse Ptger2?

For producing functional recombinant mouse Ptger2, mammalian expression systems generally yield the most physiologically relevant protein. Based on available research, HEK-293 cells represent one of the most commonly used and effective expression systems for recombinant Ptger2 production . These cells provide the necessary cellular machinery for proper protein folding, post-translational modifications, and membrane insertion of this GPCR.

When designing expression constructs, researchers should consider incorporating appropriate purification tags. Various tags can be utilized including His tags, Strep tags, and Fc fusion tags, with placement preferentially at the C-terminus to avoid interfering with the N-terminal ligand-binding domain . The addition of a signal peptide can enhance membrane targeting, while codon optimization for mammalian expression may improve yields.

For functional studies, cell-free protein synthesis (CFPS) systems have also been employed successfully for producing recombinant Ptger2 . This approach allows for rapid production and can be particularly useful for initial screening studies or when attempting to express difficult membrane proteins.

Regardless of the expression system selected, validation of functional activity through appropriate assays (ligand binding, signaling activation) is essential to confirm that the recombinant protein retains native properties.

What pharmacological tools specifically target mouse Ptger2?

Several pharmacological tools exhibit high specificity for mouse Ptger2 in experimental settings:

For selective activation of EP2 receptors, ONO-AE1-259 is considered the agonist of choice due to its high selectivity over other EP receptor subtypes . Butaprost and its free acid form are also widely used EP2-selective agonists, although they require enzymatic hydrolysis of their ester moiety to achieve full bioactivity and may show some activity at higher concentrations at other EP receptors . CP-533536 represents a non-prostanoid EP2 receptor agonist with good selectivity profile .

For antagonism of EP2 receptors, PF-04418948 is currently the antagonist of choice, having superseded the weaker, non-selective AH-6809 . PF-04418948 demonstrates excellent selectivity for EP2 over other prostanoid receptors in mouse systems and serves as a valuable tool for defining EP2 receptor-mediated responses.

When designing experiments using these pharmacological tools, researchers should always perform concentration-response analyses to determine optimal concentrations for receptor selectivity, include appropriate controls to confirm specificity, and be aware that some compounds may show species differences in potency and selectivity.

How can the functionality of recombinant Ptger2 be validated?

Validating the functionality of recombinant Ptger2 requires a multi-faceted approach employing complementary assays:

Ligand binding assays represent a fundamental validation method, using either radioligand binding with [3H]-PGE2 or fluorescently labeled PGE2 analogs to determine binding affinity (Kd) and receptor density (Bmax). Competition binding assays with known EP2-selective ligands such as ONO-AE1-259 can confirm receptor subtype specificity .

Signaling assays provide critical functional validation. Since Ptger2 couples primarily to Gs proteins, measuring cAMP accumulation following stimulation with PGE2 or selective EP2 agonists provides direct evidence of functional activity . Dose-response curves should yield EC50 values consistent with published data for native receptors. Inhibition of these responses with selective antagonists like PF-04418948 confirms specificity .

Downstream signaling events can further validate receptor functionality. Assessment of CREB phosphorylation by Western blotting following receptor activation provides evidence of intact signaling cascades . This phosphorylation should be concentration-dependent and inhibited by PKA inhibitors or EP2 antagonists.

The most robust validation combines multiple approaches, demonstrating both specific binding and appropriate signal transduction, with comparison to native tissues or cells known to express EP2 as positive controls.

How does Ptger2 signaling affect tumor-infiltrating lymphocytes?

Recent research has revealed that Ptger2 plays a critical role in regulating T cell-mediated anti-tumor immunity, particularly through its effects on stem-like CD8+ T cells. Tumor-derived PGE2 restricts the proliferative expansion and effector differentiation of TCF1+ CD8+ T cells within tumors through EP2 and EP4 receptor signaling . This mechanism contributes significantly to cancer immune escape and may limit the efficacy of current immunotherapies.

A key finding is that PGE2 does not affect the priming of TCF1+ CD8+ T cells in draining lymph nodes but specifically inhibits their function within the tumor microenvironment . This spatial specificity suggests that targeting the PGE2-EP2 axis might enhance anti-tumor immunity without broadly compromising immune responses elsewhere in the body.

Mechanistically, suppression of the interleukin-2 (IL-2) signaling pathway underlies the PGE2-mediated inhibition of TCF1+ tumor-infiltrating lymphocyte (TIL) responses . IL-2 is crucial for T cell proliferation and differentiation, and its impaired signaling effectively constrains anti-tumor immunity.

Remarkably, ablation of EP2/EP4 signaling in cancer-specific CD8+ T cells rescues their expansion and effector differentiation within tumors and has been demonstrated to lead to tumor elimination in multiple mouse cancer models . These findings identify the PGE2–EP2/EP4 axis as a promising molecular target for cancer immunotherapy.

What is the significance of the COX-2/PGE2/EP2 feedback loop in cancer models?

The COX-2/PGE2/EP2 feedback loop represents a critical self-amplifying pathway in cancer models with significant implications for tumor development and progression. This feedback mechanism operates when PGE2 activates EP2 receptors, triggering PKA/CREB signaling that upregulates COX-2 expression . The increased COX-2 then enhances PGE2 production, completing and potentially intensifying the loop .

In skin carcinogenesis models, this feedback loop promotes keratinocyte proliferation and tumor development. EP2 knockout mice show reduced COX-2 expression after TPA treatment compared to wild-type mice, while EP2 transgenic mice exhibit increased COX-2 expression . This relationship directly impacts tumor susceptibility, with reduced tumor development observed in EP2 knockout mice and enhanced tumorigenesis in EP2 overexpressing mice .

The positive feedback nature of this pathway has important therapeutic implications. Interventions that disrupt this loop at different points (COX-2 inhibition, PGE2 synthesis inhibition, or EP2 antagonism) may offer multiple strategies to suppress tumor-promoting inflammation. EP2 antagonists may provide advantages over COX inhibitors by specifically blocking the pathological effects of PGE2 while preserving beneficial prostaglandins .

How can Ptger2 knockout or overexpression models advance cancer research?

Ptger2 knockout and overexpression models provide powerful tools for elucidating this receptor's roles in cancer development and progression. For optimal utilization in cancer research, several approaches should be considered:

Conditional knockout models using Cre-loxP systems enable cell type-specific deletion of Ptger2, which is particularly valuable for dissecting the contributions of EP2 signaling in different cellular compartments (e.g., epithelial cells, endothelial cells, or specific immune cell subsets) . This approach can distinguish between direct effects on cancer cells versus effects on the tumor microenvironment.

For mechanistic investigations, ex vivo analysis of cells from knockout or overexpression models provides insights into altered signaling pathways and cellular functions. Techniques such as phospho-flow cytometry, RNA-seq, and proteomics can comprehensively characterize molecular changes resulting from modulated EP2 signaling .

Therapeutic relevance can be assessed by combining knockout models with standard treatments or immunotherapies to identify synergistic effects, suggesting potential combinatorial approaches for clinical development . These studies can help identify patient populations most likely to benefit from EP2-targeted interventions.

What controls are essential when studying Ptger2-mediated effects?

When studying Ptger2-mediated effects, particularly in complex systems like immune responses or tumor models, several essential controls should be included to ensure results are specific and interpretable:

Genetic controls are fundamental, including Ptger2 knockout cells or tissues as negative controls to confirm receptor specificity . When possible, reconstitution of Ptger2 expression in knockout cells provides powerful validation by demonstrating rescue of the phenotype. Cells expressing mutant Ptger2 with impaired signaling capacity can help distinguish between signaling-dependent and independent effects.

Pharmacological controls should include vehicle controls matching the solvent used for PGE2 or other EP2 modulators, concentration gradients to establish dose-dependence, and selective EP2 antagonists (e.g., PF-04418948) to confirm receptor specificity . Parallel studies with selective agonists/antagonists for other EP receptors help rule out contributions from those receptors. Downstream pathway inhibitors (e.g., PKA inhibitors) further confirm specific signaling mechanisms .

Biological controls might compare different cell subsets (e.g., CD4+ vs. CD8+ T cells) to identify subset-specific responses , include time-course experiments to distinguish immediate from delayed effects, and compare cells from different anatomical locations (e.g., tumor vs. draining lymph node) to assess contextual differences .

The most robust experimental designs incorporate multiple types of controls to triangulate findings and provide comprehensive validation of Ptger2-mediated effects.

How can researchers distinguish between Ptger2-specific effects and those of other PGE2 receptors?

Distinguishing between Ptger2-specific effects and those mediated by other PGE2 receptors (EP1, EP3, EP4) requires strategic experimental approaches combining genetic, pharmacological, and signaling analysis techniques:

Genetic approaches provide the most definitive evidence for receptor specificity. Using Ptger2 knockout mice or cells with CRISPR-mediated Ptger2 deletion for loss-of-function studies eliminates EP2-mediated effects . Comparing phenotypes across individual EP receptor knockout models can further identify receptor-specific contributions. Reconstitution experiments where wild-type or mutant Ptger2 is reintroduced into Ptger2-null backgrounds provide additional validation.

Pharmacological approaches complement genetic strategies through the application of receptor subtype-selective agonists like ONO-AE1-259 for EP2 and receptor subtype-selective antagonists such as PF-04418948 for EP2 . Combination approaches where multiple receptors are selectively blocked can isolate individual receptor contributions when multiple EP receptors are expressed in the system of interest.

Signaling pathway analysis leverages the distinct coupling preferences of different EP receptors: EP2 and EP4 primarily couple to Gs/cAMP/PKA, while EP1 couples to Gq/calcium and EP3 mainly to Gi . Measuring pathway-specific second messengers (cAMP for EP2/EP4, calcium for EP1, inhibition of cAMP for EP3) and receptor-specific downstream targets (e.g., CREB phosphorylation for EP2/EP4) can differentiate between receptor subtypes based on their signaling profiles.

The most convincing demonstrations of EP2-specific effects combine multiple complementary approaches rather than relying solely on any single method.

What are common pitfalls when interpreting Ptger2 research findings?

When interpreting Ptger2 research findings, particularly in complex in vivo models, researchers should be aware of several common pitfalls:

Compensatory mechanisms represent a significant challenge, as genetic deletion or chronic inhibition of Ptger2 may trigger upregulation of other EP receptors (EP1, EP3, EP4) or alternative signaling pathways that compensate for lost EP2 function . This compensation can mask or confound phenotypes. Always assess expression of other EP receptors in Ptger2 knockout models and consider using inducible knockout systems to minimize compensatory adaptations.

Cell type heterogeneity complicates interpretation since EP2 receptors are expressed on multiple cell types, including various immune cells, epithelial cells, and stromal components . Global Ptger2 deletion or systemic EP2 antagonist administration affects all these populations simultaneously. Cell type-specific knockout models or adoptive transfer approaches are essential to isolate cell-specific contributions .

Pharmacological specificity issues arise when "selective" EP2 agonists or antagonists exhibit activity at other prostanoid receptors at higher concentrations . Always validate pharmacological findings with genetic approaches and use the minimum effective concentration of compounds with careful dose-response characterization.

Context-dependent signaling means EP2 outcomes may differ dramatically depending on the inflammatory milieu, tissue microenvironment, or disease stage . Carefully control and report these contextual factors and avoid generalizing findings across different models without validation.

Secondary mediator effects occur when EP2 signaling affects production of numerous cytokines and inflammatory mediators that may themselves drive phenotypes . Distinguish direct EP2 signaling effects from those mediated by secondary factors through rescue experiments or blocking secondary mediators.

How can Ptger2 research inform cancer immunotherapy approaches?

Research on Ptger2 has significant implications for advancing cancer immunotherapy approaches, particularly through enhancing T cell-mediated anti-tumor immunity. Several key findings point toward promising therapeutic strategies:

The discovery that tumor-derived PGE2 restricts TCF1+ stem-like CD8+ T cell responses through EP2/EP4 signaling identifies a critical immune evasion mechanism . This mechanism specifically limits the expansion and differentiation of tumor-infiltrating lymphocytes with stemness properties, which are crucial for sustained anti-tumor responses and responsiveness to checkpoint inhibition. Targeting the PGE2-EP2 axis could potentially enhance the efficacy of existing immunotherapies by preserving these stem-like T cell populations.

Importantly, the observation that PGE2 does not affect T cell priming in draining lymph nodes but specifically inhibits their function within tumors suggests that EP2 targeting might enhance anti-tumor immunity without broadly compromising immune responses elsewhere . This spatial specificity could translate to a favorable therapeutic window.

Mechanistically, EP2 signaling suppresses IL-2 responsiveness in tumor-infiltrating T cells . Since IL-2 signaling is fundamental for T cell proliferation and effector function, interventions that restore IL-2 responsiveness by blocking EP2 could reinvigorate exhausted or dysfunctional TILs. This approach might be particularly valuable in "cold" tumors with limited T cell infiltration or activation.

Preclinical studies have demonstrated that genetic ablation of EP2/EP4 signaling in cancer-specific CD8+ T cells rescues their expansion and effector differentiation within tumors, leading to tumor elimination in multiple mouse cancer models . This suggests that pharmacological inhibition of these receptors could yield similar benefits in a therapeutic context.

EP2 antagonists could potentially synergize with existing immunotherapies including checkpoint inhibitors, adoptive cell therapies, and cancer vaccines by removing a key immunosuppressive pathway within the tumor microenvironment.

What methodological advances are improving Ptger2 functional studies?

Recent methodological advances have significantly enhanced our ability to study Ptger2 function across multiple research contexts:

Improved recombinant protein expression systems now allow for more efficient production of functional Ptger2 protein. Optimized mammalian expression systems using HEK-293 cells with appropriate tags (His, Strep, or Fc) have enhanced protein yield and purity . Cell-free protein synthesis (CFPS) systems represent another advance, enabling rapid production of membrane proteins like Ptger2 without the limitations of cellular expression systems .

Enhanced pharmacological tools have dramatically improved receptor targeting specificity. The development of highly selective EP2 agonists like ONO-AE1-259 and antagonists like PF-04418948 has replaced older, less selective compounds, enabling more precise interrogation of EP2-specific functions . These tools allow researchers to distinguish between effects mediated by EP2 versus other PGE2 receptors.

Single-cell technologies now permit analysis of EP2 signaling at unprecedented resolution. Single-cell RNA sequencing, mass cytometry (CyTOF), and phospho-flow cytometry enable researchers to dissect heterogeneous responses to EP2 activation within complex cell populations, particularly important in tumor microenvironments and immune contexts .

CRISPR-Cas9 genome editing has revolutionized the generation of cellular and animal models for studying Ptger2. This technology allows for precise receptor knockout or mutation, including the introduction of specific point mutations to study structure-function relationships. Inducible CRISPR systems further enable temporal control of gene editing to minimize developmental or compensatory effects.

Advanced imaging techniques including intravital microscopy allow real-time visualization of immune cell behaviors following modulation of EP2 signaling in living tissues. This approach is particularly valuable for understanding how EP2 signaling affects T cell trafficking, interactions, and function within tumor microenvironments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.