Recombinant Mouse Prostasin (Prss8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Prostasin (Prss8)

Prostasin, also known as channel activating protease 1 (CAP1), is a serine protease encoded by the Prss8 gene that exhibits trypsin-like substrate specificity . It plays a crucial role in epithelial physiology . Recombinant mouse prostasin (rmProstasin) is produced as an active form when secreted from NS0 cells .

Tissue Distribution

Prostasin is highly expressed in the prostate gland and found at lower levels in the lung, kidney, liver, salivary gland, and pancreas .

Functional Role in Epithelial Sodium Channels (ENaC) Regulation

The peptidase activity of prostasin is involved in the regulation of epithelial sodium channels (ENaC) . ENaC is critical for maintaining salt and fluid balance in the lung and kidney under both normal and pathological conditions . Prostasin activates ENaC and is considered a target for therapeutic inhibition in cystic fibrosis .

Prostasin as a Membrane-Bound and Secreted Protein

Prostasin is synthesized as a membrane-bound protein and secreted into the culture medium. The membrane-bound form can be released by phosphatidylinositol-specific phospholipase C treatment, indicating a glycosylphosphatidylinositol anchorage .

Interaction with Prostasin-Binding Protein

A prostasin-binding protein has been identified in mouse and human seminal vesicle fluid. Both secreted and membrane-bound prostasin can form a covalently linked complex when incubated with seminal vesicle fluid. This complex formation is inhibited by a prostasin antibody, heparin, and serine protease inhibitors. The serine protease activity of prostasin is inhibited when bound to the prostasin-binding protein in mouse seminal vesicle fluid .

Role in Cancer Cell Invasion

Prostasin inhibits prostate and breast cancer cell invasion in vitro, suggesting a functional role as a suppressor of tumor invasion and a regulator of gene expression during inflammation .

Zymogen-Locked Mutant Prostasin Studies

Studies using genetically modified knock-in mice with a Prss8 mutation have explored prostasin's role in ENaC activation in the kidney. These studies used mice with a Prss8 mutation abolishing proteolytic activity (Prss8-S238A) or a mutation leading to a zymogen-locked state (Prss8-R44Q) .

Therapeutic Potential

Prostasin has been proposed as a therapeutic target for cystic fibrosis due to its role in activating ENaC, which is critical for maintaining salt and fluid balance in the lung and kidney .

Effects on Glucose Tolerance and Hepatic Steatosis

Research indicates that liver-specific overexpression of prostasin can improve glucose tolerance and hepatic steatosis, independent of body weight, in mice fed a high-fat diet .

Table 2: Recombinant Mouse Prostasin (aa 30-289, His Tag) Details

ItemDescription
Synonyms2410039E18Rik, AI313909, C79772, CAP1, fr, mCAP1
SpeciesMouse
Expression HostBaculovirus-Insect Cells
SequenceAla 30-Gln 289
AccessionEDL17608.1
Calculated Molecular Weight29.3 kDa
Observed Molecular Weight35 kDa
TagC-His
Bio-activityNot validated for activity
Purity> 97 % as determined by reducing SDS-PAGE.
Endotoxin< 1.0 EU per μg of the protein as determined by the LAL method.
StorageLyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
FormulationLyophilized from sterile 20mM Tris, 500mM NaCl, pH 7.4 Normally 5% - 8% trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Prss8; Cap1; Prostasin; Channel-activating protease 1; CAP1; Serine protease 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-322
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Prss8
Target Protein Sequence
ITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQ LDSYSNDTVVHTVAQIITHSSYREEGSQGDIAFIRLSSPVTFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCA GYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHH VAELQPRVVPQTQESQPDGHLCNHHPVFSSAAAPKLLR
Uniprot No.

Target Background

Function
Recombinant Mouse Prostasin (Prss8) exhibits trypsin-like cleavage specificity, favoring poly-basic substrates. It stimulates epithelial sodium channel (ENaC) activity by activating the cleavage of its gamma subunits (SCNN1G).
Database Links
Protein Families
Peptidase S1 family
Subcellular Location
Cell membrane; Single-pass membrane protein.; [Prostasin]: Secreted, extracellular space.; [Prostasin light chain]: Secreted, extracellular space.; [Prostasin heavy chain]: Secreted, extracellular space.

Q&A

What is Prostasin (Prss8) and what are its main physiological functions?

Prostasin (Prss8) is a serine protease that is highly expressed in the distal tubule of the kidney. Its primary physiological function involves the proteolytic activation of the epithelial sodium channel (ENaC). Through this mechanism, Prostasin plays a critical role in regulating sodium balance and blood pressure. In experimental models, Prostasin has been shown to stimulate ENaC activity in co-expression systems in vitro . Beyond the kidney, Prostasin is also expressed in other epithelial tissues and has been implicated in cancer biology, particularly in ovarian cancer where it may serve as a potential tumor marker .

What structural characteristics define mouse Prostasin?

Mouse Prostasin is a trypsin-like serine protease with a catalytic triad consisting of histidine, aspartate, and serine residues (with serine at position 238 being critical for catalytic activity). The protein exists initially as a zymogen that requires proteolytic processing to become activated. Crystal structure analysis of human Prostasin (which shares high homology with mouse Prostasin) reveals that the protease domain contains important structural features including disulfide bonds that maintain protein stability . After activation, Prostasin consists of a heavy chain (~39 kDa in its glycosylated form) that becomes smaller (~26 kDa) after deglycosylation . The zymogen form typically migrates at a slightly higher molecular weight (~41 kDa glycosylated, ~28 kDa deglycosylated) compared to the activated form .

How is recombinant mouse Prostasin typically produced for research applications?

Recombinant mouse Prostasin can be produced using several expression systems, with baculovirus and bacterial expression systems being common choices. The production typically involves:

  • Construction of expression vectors containing the Prostasin sequence (residues corresponding to the mature protein, typically starting around position 33-45)

  • Replacement of the native signal sequence with an appropriate signal sequence for the expression system

  • Optional mutation of non-essential cysteines (such as C154 and C203 in human Prostasin) to improve protein stability

  • Addition of purification tags (such as His6) at the C-terminus

  • Expression in the chosen system followed by purification via affinity chromatography

For activation, the zymogen is typically converted to its active form using enterokinase in the presence of reducing agents (such as glutathione), followed by oxidation conditions to ensure proper disulfide bond formation . The final product should be purified from misfolded protein and activation enzymes for research applications .

What are the most common mutations studied in mouse Prostasin research?

Based on the available literature, two primary mutations have been extensively studied in mouse Prostasin research:

  • Prss8-S238A: This mutation abolishes the proteolytic activity of Prostasin by modifying the serine residue in the catalytic triad. While this mutation eliminates enzymatic activity, studies have shown that Prostasin-S238A can still activate ENaC in co-expression systems, suggesting that the proteolytic activity of Prostasin itself may not be essential for ENaC activation .

  • Prss8-R44Q: This mutation prevents the activation of Prostasin, keeping it in a zymogen-locked state. Studies have shown that zymogen-locked Prostasin leads to incomplete proteolytic ENaC activation in vitro and can cause severe renal phenotypes in mice when challenged with ENaC inhibitors .

Both mutations have provided valuable insights into the functional mechanisms of Prostasin in vivo and in vitro, particularly regarding its role in ENaC activation.

How does the zymogen-locked Prss8-R44Q mutation differ functionally from the catalytically inactive Prss8-S238A mutation?

The Prss8-R44Q and Prss8-S238A mutations represent distinct functional states of Prostasin with different biological consequences:

  • Prss8-S238A (catalytically inactive):

    • Preserves the proteolytically processed mature form of Prostasin

    • Despite lacking enzymatic activity, causes maximal proteolytic ENaC activation in vitro (similar to wild-type Prostasin)

    • Mice with this mutation show normal sodium conservation under low sodium diet challenge

    • These mice tolerate treatment with the ENaC inhibitor triamterene without developing severe phenotypes

  • Prss8-R44Q (zymogen-locked):

    • Remains in the unprocessed zymogen form

    • Causes only partial proteolytic ENaC activation in vitro

    • Mice with this mutation require higher plasma aldosterone concentrations to maintain sodium balance under low sodium diet

    • When challenged with triamterene, these mice develop severe salt wasting, hyperkalemia, acidosis, and renal failure

These differential phenotypes suggest that the mature conformation of Prostasin, rather than its catalytic activity, is critical for its full function in ENaC activation. The data support a model where Prostasin serves as a scaffold protein that recruits other proteases responsible for ENaC activation, with this scaffold function being impaired in the zymogen-locked state but preserved in the catalytically inactive but properly processed form .

What methodologies are most effective for studying Prostasin-mediated ENaC activation in vitro?

Based on the research literature, the following methodologies have proven effective for studying Prostasin-mediated ENaC activation:

  • Xenopus laevis oocyte expression system:

    • Co-expression of ENaC subunits (α, β, γ) with wild-type or mutant Prostasin

    • Electrophysiological measurements (two-electrode voltage clamp) to assess ENaC activity

    • Western blot analysis to monitor proteolytic processing of ENaC subunits

    • This system allows for controlled expression and functional analysis of the Prostasin-ENaC interaction

  • Cell surface protease activity assays:

    • Measurement of protease activity at the cell surface using specific fluorogenic substrates

    • Comparison of activity between wild-type and mutant Prostasin variants

    • This approach can help distinguish between alterations in protease activity versus expression or localization

  • Western blot analysis of ENaC processing:

    • Detection of full-length and cleaved forms of ENaC subunits (particularly α and γ)

    • Analysis under reducing and non-reducing conditions to assess disulfide bond rearrangements

    • Deglycosylation treatments to resolve processing events independent of glycosylation differences

These complementary approaches allow researchers to dissect the molecular mechanisms of Prostasin-mediated ENaC activation, distinguishing between effects on protease activity, protein-protein interactions, and downstream proteolytic processing events.

What experimental challenges arise when working with kidney-specific Prss8 knockout models, and how can they be addressed?

Working with kidney-specific Prss8 knockout models presents several experimental challenges:

  • Distinguishing direct from compensatory effects:

    • Challenge: Complete absence of Prostasin may trigger compensatory upregulation of other proteases or alternative ENaC activation pathways

    • Solution: Complementary studies with catalytically inactive (Prss8-S238A) and zymogen-locked (Prss8-R44Q) mutants provide more nuanced insights than simple knockout models

    • Analysis of expression levels of other potential ENaC-activating proteases (e.g., matriptase/ST14) should be performed

  • Phenotypic analysis under various physiological challenges:

    • Challenge: Normal phenotype under standard conditions may mask conditional defects

    • Solution: Subject mice to various challenges including:

      • Low sodium diet to test ENaC-dependent sodium conservation

      • Diuretic treatment (e.g., triamterene) to reveal ENaC functional deficiencies

      • Combined challenges to unmask compensatory mechanisms

  • Tissue-specific and inducible deletion systems:

    • Challenge: Constitutive kidney-specific knockout may affect development

    • Solution: Use of Pax8-rTA and TRE-LC1 transgenic systems allows for inducible, kidney-specific deletion of Prss8 in adult mice

    • This approach separates developmental from physiological effects

  • Comprehensive assessment of sodium handling:

    • Challenge: Seemingly normal sodium balance may mask subtle defects

    • Solution: Comprehensive metabolic analysis including:

      • Measurement of plasma and urinary electrolytes

      • Aldosterone levels as indicator of compensatory mechanisms

      • Protein expression analysis of multiple sodium transporters (ENaC, NCC, NKCC2, ROMK)

Through these approaches, researchers can overcome the limitations of simple knockout models and gain deeper insights into the multifaceted roles of Prostasin in kidney physiology.

How does the proteolytic processing of mouse Prostasin differ in vivo versus recombinant expression systems?

The proteolytic processing of mouse Prostasin shows important differences between in vivo contexts and recombinant expression systems:

In vivo processing (kidney tissue):

  • Wild-type Prostasin appears predominantly in its processed form (~39 kDa glycosylated, ~26 kDa deglycosylated)

  • Catalytically inactive Prss8-S238A mutant is also properly processed, similar to wild-type

  • Zymogen-locked Prss8-R44Q mutant remains unprocessed (~41 kDa glycosylated, ~28 kDa deglycosylated)

  • Processing likely involves endogenous activators such as matriptase/ST14, which shows consistent expression across genotypes

In recombinant expression systems:

  • When expressed in oocytes or insect cells, prostasin typically requires exogenous activation

  • For baculovirus expression, the native signal sequence and propeptide are usually replaced with insect cell signal sequences

  • Activation typically requires addition of specific proteases like enterokinase

  • Processing conditions need careful optimization with reducing agents (0.5 mM reduced glutathione) followed by oxidizing conditions (1 mM oxidized glutathione)

Key differences:

  • In vivo, processing occurs through endogenous pathways involving tissue-specific proteases

  • Recombinant systems require engineered constructs and controlled activation conditions

  • Post-translational modifications (particularly glycosylation) may differ between systems

  • Zymogen-locked mutations (R44Q) prevent processing in both systems, while catalytically inactive mutations (S238A) still allow processing

Understanding these differences is crucial when interpreting results from recombinant protein studies and extrapolating to physiological contexts.

What is the evidence for Prostasin serving as a scaffold protein rather than directly activating ENaC through its catalytic activity?

Several lines of evidence support the hypothesis that Prostasin functions as a scaffold protein that recruits other proteases for ENaC activation, rather than directly cleaving ENaC through its own catalytic activity:

  • Catalytically inactive Prostasin retains ENaC-activating function:

    • Prss8-S238A mutant (lacking proteolytic activity) causes maximal proteolytic ENaC activation in oocyte co-expression studies, comparable to wild-type Prostasin

    • Mice carrying the Prss8-S238A mutation show normal sodium conservation under low sodium diet and normal responses to ENaC inhibitors

  • Zymogen-locked Prostasin shows impaired function:

    • Prss8-R44Q mutant (unable to undergo conformational activation) causes only partial ENaC activation in vitro

    • Mice with this mutation show increased aldosterone levels to maintain sodium balance and develop severe phenotypes when challenged with ENaC inhibitors

  • Biochemical evidence of proteolytic processing:

    • Western blot analysis shows that ENaC subunits undergo proteolytic processing in the presence of catalytically inactive Prss8-S238A

    • This indicates that another protease must be responsible for the observed proteolytic processing

  • Genetic studies with different Prostasin mutants:

    • CAP1/Prss8-deficient mice and catalytically inactive mutants (Prss8cat/cat) maintain similar proteolytic processing of ENaC subunits (α and γ ENaC)

    • This further confirms that Prostasin's catalytic activity is dispensable for ENaC activation in vivo

These findings collectively suggest a model where the mature, properly folded Prostasin serves as a critical scaffold that recruits or positions other proteases (possibly matriptase or other serine proteases) for efficient ENaC activation, independent of its own proteolytic activity .

What are the optimal conditions for activating recombinant mouse Prostasin zymogen for functional studies?

Based on the available research, the following protocol outlines optimal conditions for activating recombinant mouse Prostasin zymogen:

  • Expression and initial purification:

    • Express recombinant Prostasin with a purification tag (typically His6)

    • Purify using nickel affinity chromatography under native conditions

    • Confirm identity and purity via SDS-PAGE and mass spectrometry

  • Zymogen activation conditions:

    • Add enterokinase at 2 units/ml (approximately 7.5 units/mg prostasin)

    • Include reducing agent: 0.5 mM reduced glutathione

    • Incubate at 4°C for 48 hours

    • Monitor cleavage progression by mass spectrometry and SDS-PAGE

    • Once cleavage is complete, add 1 mM oxidized glutathione

    • Incubate overnight at 4°C to ensure proper disulfide bond formation

  • Post-activation purification:

    • Remove enterokinase and misfolded Prostasin via secondary purification

    • Typically accomplished using Ni(II) affinity and anion exchange chromatography

    • Select fractions based on activity assays

    • For crystallography or other applications requiring high purity, concentrate to 12-14 mg/ml in 50 mM Tris/HCl, pH 8.5, 0.1 M NaCl

This protocol has been successfully used to produce active Prostasin for structural and functional studies, with evidence that the resulting protein adopts the correct conformation and maintains appropriate activity profiles .

What experimental models best demonstrate the physiological relevance of Prostasin in ENaC regulation?

Based on the research literature, several experimental models have proven valuable for demonstrating the physiological relevance of Prostasin in ENaC regulation:

  • Genetically modified mouse models:

    • Specific mutations: Prss8-S238A (catalytically inactive) and Prss8-R44Q (zymogen-locked) provide complementary insights into structural versus enzymatic requirements

    • Kidney-specific knockouts: Using Pax8-rTA/TRE-LC1 system for inducible, tissue-specific deletion of Prostasin in adult kidney epithelium

    • Combined approach: Comparing constitutive mutations with conditional knockouts helps distinguish direct effects from compensatory mechanisms

  • Physiological challenge paradigms:

    • Low sodium diet: Tests the ability of mice to conserve sodium through ENaC upregulation

    • ENaC inhibitor challenge: Treatment with triamterene reveals functional dependencies on Prostasin that may be masked under normal conditions

    • Combined challenges: Low sodium diet followed by ENaC inhibition provides the most stringent test of Prostasin's role

  • Comprehensive phenotyping approaches:

    • Metabolic parameters: Measurement of plasma electrolytes, aldosterone levels, body weight, food and water intake

    • Molecular analysis: Western blotting of ENaC subunits (α, β, γ) with attention to cleaved fragments

    • Transporter profiling: Assessment of other sodium transporters (NCC, NKCC2) and potassium channels (ROMK) to detect compensatory changes

The most definitive insights come from combining these approaches, particularly when examining the phenotypes of different Prostasin mutants under various physiological challenges. This multi-faceted approach has revealed that Prostasin's role in ENaC regulation is complex and involves more than just its catalytic activity .

How should researchers interpret contradictory findings between in vitro and in vivo studies of Prostasin function?

When faced with contradictory findings between in vitro and in vivo studies of Prostasin function, researchers should consider the following interpretative framework:

  • Recognize inherent limitations of each system:

    • In vitro systems (e.g., oocyte expression) provide controlled environments but lack tissue-specific factors and compensatory mechanisms

    • In vivo models capture physiological complexity but may mask direct effects through compensation or redundancy

  • Consider protein processing differences:

    • Recombinant Prostasin often requires artificial activation steps not present in vivo

    • Post-translational modifications (glycosylation, GPI anchoring) may differ between systems

    • Availability of cofactors and interacting partners varies between systems

  • Reconciliation strategies:

    • Complementary mutations: Compare catalytically inactive (S238A) and zymogen-locked (R44Q) mutants in both systems

    • Challenge paradigms: Physiological challenges (low sodium, diuretics) may reveal phenotypes not apparent under baseline conditions

    • Molecular profiling: Detailed analysis of ENaC processing and other transporters can bridge in vitro and in vivo observations

  • Example of successful reconciliation:
    The apparent contradiction that Prostasin-deficient mice maintain normal sodium balance despite Prostasin's established role in ENaC activation was resolved through:

    • Demonstrating that catalytically inactive Prostasin still supports ENaC activation

    • Showing that the zymogen-locked form has more severe phenotypes than the catalytically inactive form

    • Revealing that physiological challenges unmask dependencies not seen under baseline conditions

    • Proposing a scaffold model where Prostasin's structure, not its activity, is critical for ENaC regulation

This integrated approach demonstrates how apparent contradictions can lead to more sophisticated models of protein function that accommodate both in vitro and in vivo observations.

What are the most promising approaches for identifying the endogenous proteases that interact with Prostasin in its scaffold function?

Given the evidence supporting Prostasin's role as a scaffold protein rather than a direct ENaC activator, the following approaches hold promise for identifying its interacting proteases:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion proteins to identify proteins in close proximity to Prostasin in native tissues

    • APEX2-based proximity labeling in kidney cell lines expressing wild-type versus mutant Prostasin

    • These methods could identify transient or weak interactions that might be missed by conventional co-immunoprecipitation

  • Comparative proteomic analysis:

    • Mass spectrometry-based comparison of protein complexes immunoprecipitated with wild-type, S238A, and R44Q Prostasin variants

    • Focus on differential interactions between properly folded (wt, S238A) versus zymogen-locked (R44Q) forms

    • Analysis of kidney tissue from mice under normal conditions versus sodium restriction

  • Candidate approach based on known serine proteases:

    • Targeted analysis of matriptase/ST14, which has been reported as a candidate for Prostasin activation

    • Investigation of other membrane-associated serine proteases expressed in the distal nephron

    • Functional validation through siRNA knockdown or CRISPR/Cas9 editing in cell models

  • Cross-linking mass spectrometry:

    • Use of chemical cross-linkers to stabilize transient interactions

    • Analysis of cross-linked complexes using specialized mass spectrometry workflows

    • This approach could capture the Prostasin "interactome" in its native environment

These complementary approaches could reveal the key proteases that interact with Prostasin to mediate ENaC activation, potentially identifying new therapeutic targets for disorders of sodium handling.

How might the dual role of Prostasin in kidney function and cancer biology be reconciled mechanistically?

The dual role of Prostasin in kidney homeostasis and cancer biology presents an intriguing mechanistic puzzle that could be approached through several investigative strategies:

  • Comparative expression and processing analysis:

    • Analyze Prostasin expression, proteolytic processing, and glycosylation patterns in normal versus cancerous tissues

    • In ovarian cancer, Prostasin appears to be overexpressed compared to normal tissues

    • Determine whether cancer-associated Prostasin maintains its normal processing and activation patterns

  • Functional pathway analysis:

    • Kidney function: Prostasin regulates ENaC through a scaffold function independent of its catalytic activity

    • Cancer biology: Investigate whether Prostasin's role in cancer similarly depends on protein-protein interactions rather than direct proteolytic activity

    • Compare the effects of catalytically inactive (S238A) versus zymogen-locked (R44Q) mutations in cancer models

  • Interactome comparison:

    • Identify tissue-specific and condition-specific interaction partners

    • Determine whether Prostasin interacts with different sets of proteins in normal versus cancerous contexts

    • Focus on whether the scaffold function engages different downstream effectors

  • Signaling pathway integration:

    • Explore how Prostasin-mediated regulation of ion channels might influence cancer cell signaling

    • Investigate potential links between ion homeostasis and cancer cell proliferation or migration

    • Consider whether Prostasin's role in cancer might involve regulation of epithelial barrier function

These approaches could reveal whether Prostasin's dual roles share common mechanistic features or represent distinct functions in different cellular contexts, potentially identifying new therapeutic opportunities that target cancer-specific functions while preserving normal physiological roles.

What technological advances would enhance our ability to study the structure-function relationship of Prostasin in ENaC regulation?

Several technological advances could significantly enhance our understanding of Prostasin's structure-function relationship in ENaC regulation:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy of Prostasin-ENaC complexes to visualize interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes between wild-type, S238A, and R44Q Prostasin

    • Single-particle analysis of multi-protein complexes involving Prostasin and potential partner proteases

  • Live-cell imaging approaches:

    • Super-resolution microscopy to visualize Prostasin-ENaC interactions in native membrane environments

    • FRET-based sensors to detect conformational changes in Prostasin upon interaction with ENaC or other proteases

    • Single-molecule tracking to monitor the dynamics of Prostasin-ENaC complexes in live cells

  • Genome engineering for physiological models:

    • CRISPR-based precise editing to introduce specific mutations (e.g., S238A, R44Q) in human kidney organoids

    • Conditional alleles with tissue-specific and temporal control for more refined in vivo models

    • Humanized mouse models expressing human Prostasin and ENaC variants to better translate findings

  • Functional proteomics approaches:

    • Activity-based protein profiling to identify active proteases in the vicinity of Prostasin

    • Crosslinking-coupled mass spectrometry to capture transient protein-protein interactions

    • Targeted proteomics for quantitative analysis of ENaC processing in various experimental conditions

These technological advances would allow researchers to bridge the gap between structural insights and functional outcomes, potentially revealing how Prostasin's conformation enables its scaffold function and how this is altered in disease states or therapeutic interventions.

Comparative analysis of wild-type and mutant Prostasin effects on ENaC activation

Table 1: Functional comparison of wild-type and mutant Prostasin variants

Prostasin VariantProteolytic ActivityENaC Activation in vitroSodium Conservation (Low Na+ diet)Response to TriamtereneProcessing State
Wild-type (Prss8-wt)PresentMaximalNormalTolerantProcessed (~39 kDa)
Catalytically inactive (Prss8-S238A)AbsentMaximalNormalTolerantProcessed (~39 kDa)
Zymogen-locked (Prss8-R44Q)AbsentPartialNormal (with higher aldosterone)Salt wasting, hyperkalemia, acidosisUnprocessed (~41 kDa)

This table summarizes key findings from studies comparing wild-type Prostasin with its catalytically inactive (S238A) and zymogen-locked (R44Q) mutants. The data demonstrates that proteolytic processing of Prostasin, rather than its catalytic activity, is critical for full ENaC activation .

Molecular characteristics of recombinant Prostasin expression systems

Table 2: Properties of recombinant Prostasin expression constructs

Construct FeatureBaculovirus ExpressionBacterial ExpressionMammalian Expression
Signal sequenceInsect cell (melittin, GP64, or GP67)Native propeptideNative or optimized mammalian
Residue rangeTypically 45-285/289Typically includes propeptideTypically full-length
Common mutationsC154S, C203AC154S, C203AVariable
Purification tagC-terminal His6C-terminal His6His6 or Fc
Activation methodEnterokinaseEnterokinaseOften autocatalytic
GlycosylationPresent (insect pattern)AbsentPresent (mammalian pattern)
Typical yieldModerate-highVariableLow-moderate

This table provides guidance for researchers selecting expression systems for recombinant Prostasin production. The choice of system impacts post-translational modifications, activation requirements, and protein characteristics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.