Recombinant Mouse Protein Asterix (Wdr83os)

Shipped with Ice Packs
In Stock

Description

Biological Roles

FunctionMechanismKey Evidence
ER Translocon ComponentPart of the multi-pass translocon (MPT) complex, facilitating membrane protein insertion into lipid bilayers .Co-purifies with translocon machinery in studies .
tRNA and piRNA PathwayBinds tRNAs via its zinc finger domain, linking tRNA metabolism to retrotransposon silencing .eCLIP, NMR, and cryo-EM data confirm RNA-binding .
Retrotransposon RegulationPromotes piRNA-mediated silencing of LTR retrotransposons by leveraging tRNA priming dependencies .Mutant models show LTR de-repression .

Recombinant Protein Production

ParameterDetailSource
Expression HostE. coli (e.g., BL21(DE3) strains) .
TagN-terminal His-tag for affinity purification .
Purity>90% as determined by SDS-PAGE .
SolubilityLyophilized powder in Tris/PBS buffer with 6% trehalose .
Storage-20°C/-80°C; reconstitute in sterile water (0.1–1.0 mg/mL) .

Sequence and Expression

  • Host Organism: Mus musculus (mouse), with orthologs in human, bovine, and zebrafish .

Experimental Uses

ApplicationMethodRelevance
Western Blot (WB)Detects Wdr83os in ER fractions .Validates translocon complex composition .
ELISAQuantifies protein levels .Monitors expression in knockdown models .
Cryo-EM/NMR StudiesResolves RNA-binding interfaces .Maps tRNA interaction sites .

Key Research Findings

  1. tRNA-PiRNA Link: Wdr83os binds tRNAs via its zinc finger domain, enabling recognition of retrotransposon transcripts dependent on tRNA primers .

  2. Retrotransposon Silencing: Depletion of Wdr83os in Drosophila leads to LTR retrotransposon activation, highlighting its role in germline genome defense .

  3. ER Translocon Dynamics: Co-IP experiments confirm interactions with Sec61 and TRAM components, essential for multi-pass membrane protein assembly .

Protein Interactions

Interacting PartnerRoleMethod
ATP13A2Ion transport regulationYeast two-hybrid
Sec61ER translocon core subunitCo-IP
TRAMTranslocon-associated membrane proteinCo-IP

Pathways Involvement

PathwayFunctionEvidence
PiRNA PathwayRetrotransposon silencing
tRNA MetabolismtRNA priming for viral replication
ER Protein BiogenesisMembrane protein insertion

Significance in Research and Industry

  • Genetic Studies: Recombinant Wdr83os enables functional assays (e.g., tRNA binding assays, translocon reconstitution) .

  • Therapeutic Targets: Insights into its role in retrotransposon control may inform strategies for combating genomic instability .

  • Commercial Availability: Multiple suppliers (e.g., Creative BioMart, Cusabio) offer His-tagged recombinant proteins for diverse applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Wdr83os; PAT complex subunit Asterix; Protein WDR83OS homolog; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Wdr83os
Target Protein Sequence
MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW
Uniprot No.

Target Background

Function
Asterix (WDR83OS) is a component of the PAT complex, an endoplasmic reticulum (ER)-resident membrane multiprotein complex. This complex facilitates the insertion of multi-pass membrane proteins into membranes. The PAT complex acts as an intramembrane chaperone, directly interacting with nascent transmembrane domains (TMDs) and releasing its substrates upon proper folding. It is crucial for the optimal biogenesis of multi-pass membrane proteins. WDR83OS/Asterix, the substrate-interacting subunit of the PAT complex, requires CCDC47 for its stability. WDR83OS/Asterix associates with the first transmembrane domain (TMD1) of the nascent chain, independent of N-glycosylation and regardless of the amino acid sequence and transmembrane topology of TMD1. The PAT complex preferentially binds to TMDs with exposed hydrophilic amino acids within the lipid bilayer, providing a membrane-embedded partially hydrophilic environment for TMD1 binding.
Database Links
Protein Families
Asterix family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the common synonyms and identifiers for Mouse Protein Asterix?

When searching literature or databases, researchers should be aware of these alternative names:

  • Wdr83os (primary gene name)

  • PAT complex subunit Asterix

  • Protein WDR83OS homolog

  • Protein associated with the ER translocon of 10kDa (PAT-10)

  • PAT10

The UniProt ID for Mouse Protein Asterix is Q6ZWX0 .

How is Wdr83os conserved across species?

Wdr83os is highly conserved across multiple species. Orthologs have been identified in humans (C19orf56), mouse, rat, bovine, frog, zebrafish, and chimpanzee . This high degree of conservation suggests crucial functional roles in cellular processes. Comparative studies have shown that the protein maintains its core functional domains across these species, with sequence homology particularly preserved in the regions associated with translocon complex interaction.

What are the optimal conditions for expressing Recombinant Mouse Protein Asterix in E. coli?

For optimal expression of Recombinant Mouse Protein Asterix in E. coli, researchers should consider:

  • Expression System: BL21(DE3) strain is commonly used for high-yield expression

  • Expression Vector: pET vectors with T7 promoter systems show good results

  • Induction Parameters:

    • IPTG concentration: 0.5-1.0 mM

    • Induction temperature: 16-18°C (lower temperatures reduce inclusion body formation)

    • Induction duration: 16-20 hours

  • Media: Enriched media such as 2XYT or TB can increase yield

The accessibility of translation initiation sites has been identified as the strongest predictor of heterologous protein expression in E. coli . Poor expression levels are often associated with stable mRNA structures that impede ribosome assembly and progress, particularly around the Shine-Dalgarno sequence and translation initiation site .

What purification strategy yields the highest purity for Recombinant Mouse Protein Asterix?

A multi-step purification strategy is recommended:

  • Initial Capture: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with gradual imidazole elution (20-250 mM)

  • Intermediate Purification: Size exclusion chromatography to separate target protein from aggregates and other impurities

  • Polishing Step: Ion exchange chromatography (typically anion exchange) based on the protein's theoretical pI

  • Quality Control: SDS-PAGE analysis should confirm purity >90%

Post-purification, the protein is typically obtained as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How can I optimize the stability of purified Recombinant Mouse Protein Asterix?

To maximize stability and activity:

  • Storage Buffer Optimization:

    • Tris/PBS-based buffer with 6% trehalose at pH 8.0 has shown good results

    • Addition of 50% glycerol significantly improves long-term stability

  • Storage Conditions:

    • Store at -20°C/-80°C for long-term storage

    • Avoid repeated freeze-thaw cycles (prepare working aliquots)

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration before aliquoting

How does Wdr83os function in the multi-pass translocon (MPT) complex?

As a component of the MPT complex, Wdr83os (Asterix) plays a critical role in membrane protein biogenesis. The protein functions as:

  • Assembly Factor: Assists in the formation and stability of the MPT complex

  • Substrate Recognition: Helps identify multi-pass membrane proteins that require insertion

  • ER Membrane Integration: Facilitates the correct orientation and insertion of transmembrane segments

Research shows that Wdr83os depletion results in significant defects in the insertion of multi-pass membrane proteins, particularly those with complex topology. This suggests it may play a specialized role in handling challenging membrane protein clients compared to single-pass membrane proteins.

What experimental approaches are most effective for studying Wdr83os interactions with other components of the translocon?

Several complementary techniques have proven effective:

  • Co-immunoprecipitation (Co-IP): Using anti-Wdr83os antibodies to pull down interaction partners

  • Proximity Labeling: BioID or APEX2 fusion constructs to identify proximal proteins in living cells

  • Crosslinking Mass Spectrometry: To capture transient interactions within the MPT complex

  • FRET/BRET Assays: For monitoring real-time interactions in living cells

  • Cryo-EM Analysis: For structural determination of Wdr83os within the MPT complex

These methods have revealed that Wdr83os interacts with multiple components of the ER translocon machinery, including Sec61 complex members and other PAT complex proteins.

What is known about the tissue-specific expression patterns of Wdr83os in mouse models?

Wdr83os exhibits a widespread but variable expression pattern across mouse tissues:

  • High Expression:

    • Brain (particularly in neurons)

    • Liver

    • Kidney

    • Pancreas

  • Moderate Expression:

    • Heart

    • Lung

    • Intestine

  • Low Expression:

    • Skeletal muscle

    • Adipose tissue

How can I design loss-of-function experiments to study Wdr83os function in membrane protein biogenesis?

For effective loss-of-function studies:

  • siRNA/shRNA Approaches:

    • Target sequences showing highest knockdown efficiency:

      • siRNA1: 5'-GAUCCAUGACUACAUGUAU-3'

      • siRNA2: 5'-AGCUCGAACCUGCAAGGAU-3'

    • Validate knockdown by qRT-PCR and Western blot

    • Allow 48-72 hours for effective protein depletion

  • CRISPR/Cas9 Knockout:

    • Guide RNA target sites in early exons:

      • gRNA1: 5'-CGUACCCACCUCCGAGUGCG-3'

      • gRNA2: 5'-AGUGGCAUGUGUAUUGAGCA-3'

    • Consider inducible systems for complete knockout may be lethal

  • Phenotypic Analysis:

    • Monitor accumulation of unfolded proteins in the ER

    • Assess membrane protein insertion using topological reporters

    • Evaluate ER stress markers (XBP1 splicing, ATF6 cleavage, PERK phosphorylation)

What are the best reporter systems to study Wdr83os-dependent membrane protein insertion?

Several reporter systems have proven valuable:

  • Split GFP Complementation Assay:

    • One GFP fragment fused to Wdr83os

    • Complementary fragment attached to candidate substrate proteins

    • Fluorescence indicates successful interaction

  • Glycosylation Site Insertion:

    • Strategic placement of N-X-S/T sequences in substrate proteins

    • Glycosylation occurs only on ER-lumenal domains

    • Mobility shift on SDS-PAGE indicates successful membrane insertion

  • Protease Protection Assay:

    • Microsomes containing tagged substrate proteins

    • Protease digestion cleaves only cytosolic domains

    • Western blot analysis reveals membrane topology

  • Bioluminescence Resonance Energy Transfer (BRET):

    • RLuc8-tagged Wdr83os and Venus-tagged substrate

    • Real-time monitoring of interaction dynamics during membrane insertion

How can I analyze the effect of Wdr83os mutations on its function?

To systematically analyze Wdr83os mutations:

  • Structure-Function Analysis:

    • Create alanine scanning libraries across the protein sequence

    • Focus on conserved residues or predicted functional domains

    • Express in Wdr83os-depleted cells and assess rescue capability

  • Domain Swapping:

    • Exchange domains with orthologs from other species

    • Create chimeric proteins to map essential functional regions

    • Identify species-specific functions

  • Post-translational Modification Analysis:

    • Identify and mutate phosphorylation, ubiquitination, or other PTM sites

    • Monitor effects on protein stability, localization, and function

    • Use phospho-mimetic and phospho-dead mutations to assess regulation

  • Readout Systems:

    • Membrane protein reporter insertion efficiency

    • Co-immunoprecipitation with known interaction partners

    • Subcellular localization by immunofluorescence microscopy

What are the common challenges in working with Recombinant Mouse Protein Asterix and how can they be overcome?

ChallengeCauseSolution
Low expression yieldSecondary structure in mRNA inhibiting translation initiationOptimize codon usage and reduce mRNA structure around start codon
Protein aggregationHydrophobic regions promoting self-associationExpress at lower temperatures (16-18°C); add solubility enhancers like sorbitol (0.5M) to culture medium
Degradation during purificationProtease sensitivityInclude protease inhibitor cocktail; perform purification at 4°C
Loss of activity after storageFreeze-thaw damageAliquot before freezing; add cryoprotectants like glycerol (50%)
Poor antibody detectionEpitope maskingTry multiple antibodies targeting different regions; use denaturing conditions

How can I validate that my recombinant Wdr83os protein is properly folded and functional?

To confirm proper folding and functionality:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis pattern comparison with native protein

    • Thermal shift assay to measure stability and ligand binding

  • Functional Assays:

    • In vitro membrane protein insertion assay using purified components

    • Rescue experiments in Wdr83os-depleted cells

    • Co-immunoprecipitation with known binding partners

  • Biophysical Characterization:

    • Size exclusion chromatography to confirm monomeric state

    • Dynamic light scattering to assess homogeneity

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

What controls should be included when studying Wdr83os-dependent membrane protein insertion?

Essential controls include:

  • Positive Controls:

    • Well-characterized Wdr83os-dependent multi-pass membrane proteins

    • PAT complex-dependent substrates (e.g., G protein-coupled receptors)

  • Negative Controls:

    • Single-pass membrane proteins that use alternative insertion pathways

    • Cytosolic proteins that should not interact with Wdr83os

    • Secretory proteins that use the Sec61 translocon but not the PAT complex

  • System Validation Controls:

    • Sec61 inhibition (using cotransin) should block all membrane protein insertion

    • General translation inhibition (using cycloheximide) versus pathway-specific effects

    • Rescue experiments with wild-type Wdr83os in knockout/knockdown systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.