Recombinant Mouse Protein ATP1B4 (Atp1b4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Protein ATP1B4 (Atp1b4)

The ATP1B4 gene encodes BetaM proteins, which belong to the X, K-ATPase $$\beta$$-subunit gene family (where X = Na or H) . ATP1B4 represents an instance of orthologous vertebrate gene co-option that creates significant changes in the functional properties of the encoded BetaM proteins .

Role in Muscle Gene Expression

Eutherian BetaM regulates muscle gene expression by promoting changes in chromatin structure . It stimulates the expression of the muscle regulatory factor (MRF), MyoD, independently of SKIP . BetaM binds to the distal regulatory region (DRR) of MyoD, promotes epigenetic changes associated with the activation of transcription, and recruits the SWI/SNF chromatin remodeling subunit, BRG1 .

Binding to E-box4 and CArG Elements

BetaM and SKIP bind to both E-box4 and CArG elements of the DRR . BetaM activates wild-type DRR luciferase activity two-fold over vector control when both E-box4 and CArG elements are present but fails to activate luciferase activity when either or both are deleted .

Promotion of BRG1 Recruitment and Histone Modifications

BetaM enhances BRG1 recruitment to the MyoD DRR and enhances the levels of two epigenetic marks that are associated with actively transcribed promoters: histone H4 acetylation and histone H3K4 tri-methylation .

Interaction with Other Proteins

BetaM interacts with lamina-associated protein LAP1 and myocyte nuclear envelope protein SYNE1, which could potentially be involved in promoting epigenetic changes required for muscle development . The role of BetaM in the regulation of muscle gene expression may involve interactions with LAP1 and SYNE1 .

Functional consequences of BetaM and LAP1 interactions

Lamina-associated proteins are attractive candidates for mediating the observed epigenetic changes induced by BetaM on the MyoD promoter . Beta-M promotes MyoD expression by recruiting the BRG1 component of the SWI/SNF chromatin complex and enhancing histone covalent modifications associated with gene activation . BetaM may be involved in chromatin organization because of its positioning in the nuclear envelope .

sFRP-4 and Wnt Signaling

Secreted Frizzled Related Protein-4 (sFRP-4) belongs to a family of Wnt-binding proteins with homology to the ligand-binding domain of the Frizzled receptors . Mature mouse sFRP-4 shares 92% and 96% amino acid (aa) sequence identity with human and rat sFRP-4, respectively . Recombinant Mouse sFRP-4 activates Wnt induced TCF reporter activity in HEK293 human embryonic kidney cells .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atp1b4; Protein ATP1B4; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG KEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS LNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYPESASFDLRYYPYYGK LTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET
Uniprot No.

Target Background

Function
ATP1B4 may function as a transcriptional coregulator during muscle development by interacting with SNW1. It has lost its ancestral role as a Na,K-ATPase β-subunit.
Gene References Into Functions
  1. Primary structure determination and analysis of the developmental regulation of the ATP1B4 gene. PMID: 14656723
  2. During evolution, ATP1B4 lost its ancestral function, accumulating in the nuclear membrane of perinatal myocytes and associating with the transcriptional coregulator Ski-interacting protein (SKIP). PMID: 17592128
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in skeletal muscle (at protein level). Expressed during postnatal development in skeletal muscle and heart.

Q&A

What is the current understanding of ATP1B4's function in mice?

In mice, ATP1B4 has evolved to serve functions distinctly different from its ancestral role. The BetaM protein encoded by ATP1B4 in mice is predominantly expressed in skeletal and cardiac muscle tissues, where it localizes to the inner nuclear membrane . The protein reaches its highest expression levels during perinatal development and is implicated in gene regulation . Studies with BetaM-deficient mice (Atp1b4-/Y) have revealed its significant role in metabolic regulation, as these knockout mice exhibit dramatically altered metabolic parameters including lower body weight, reduced adiposity, enhanced insulin sensitivity, improved glucose tolerance, and increased energy expenditure . These findings suggest that mouse ATP1B4 plays an important role in regulating metabolism and energy homeostasis.

What structural features characterize the recombinant mouse ATP1B4 protein?

Recombinant mouse ATP1B4 protein retains the structural signature motifs of X,K-ATPase β-subunits, which are type II membrane glycoproteins, but with significant evolutionary modifications . The most notable structural feature is the acquisition of an extended N-terminal domain containing:

  • An N-terminal Arg-rich nonapeptide that serves as a nuclear localization signal

  • Two extended Glu-rich clusters that form intrinsically disordered domains

  • Homopolymeric amino acid repeats that function as flexible molecular recognition elements

These structural modifications enable the protein to interact with a diverse range of binding partners and are crucial for its nuclear localization and function in gene regulation .

What are the recommended protocols for reconstitution and storage of recombinant mouse ATP1B4?

While specific reconstitution protocols for recombinant mouse ATP1B4 are not explicitly detailed in the provided data, general principles for handling recombinant proteins can be applied based on similar proteins. Recombinant mouse ATP1B4 produced in E. coli expression systems is typically lyophilized and should be reconstituted in an appropriate buffer, such as PBS, at a concentration of approximately 1.00 mg/mL .

For storage considerations:

  • Store the unopened lyophilized product at -20°C to -70°C

  • Use a manual defrost freezer to avoid temperature fluctuations

  • Avoid repeated freeze-thaw cycles that can compromise protein integrity

  • Once reconstituted, aliquot the protein to minimize freeze-thaw cycles

  • Do not use past the expiration date

These recommendations align with standard practices for handling recombinant proteins and can be adapted specifically for mouse ATP1B4 research applications .

How can researchers effectively verify the functional activity of recombinant mouse ATP1B4?

Verifying the functional activity of recombinant mouse ATP1B4 requires specialized approaches that differ from those used for its ancestral form in lower vertebrates. Since eutherian ATP1B4 has lost its Na,K-ATPase function, researchers should focus on validating its gene regulatory and protein interaction capabilities:

  • Protein-Protein Interaction Assays: Yeast two-hybrid or split-ubiquitin systems can be used to verify interactions with known binding partners such as the transcriptional co-regulator SKIP, lamina-associated protein LAP-1, Syne1, and transcription factor LZIP/CREB3 .

  • Subcellular Localization Verification: Immunofluorescence microscopy to confirm proper localization to the inner nuclear membrane of muscle cells.

  • Gene Expression Analysis: RNA-seq or qPCR to measure changes in expression of genes known to be regulated by ATP1B4.

  • Truncation Analysis: Creating truncated forms of the protein to verify that residues 72-98 in the nucleoplasmic domain are critical for interaction with binding partners such as SKIP .

  • SDS-PAGE Analysis: Verification of protein integrity through SDS-PAGE under reducing and non-reducing conditions, with expected bands corresponding to the predicted molecular weight.

These methodological approaches allow researchers to verify both the structural integrity and functional activity of recombinant mouse ATP1B4 in experimental settings.

How can ATP1B4 knockout models be utilized to study metabolic disorders?

BetaM-deficient mice (Atp1b4-/Y) exhibit a remarkable metabolic phenotype that makes them valuable for studying metabolic disorders and potential therapeutic interventions. These mice demonstrate:

  • Enhanced metabolic parameters:

    • Significantly lower body weight and remarkably low adiposity

    • Lower fasting blood glucose

    • Enhanced insulin sensitivity

    • Improved glucose tolerance

  • Altered energy homeostasis:

    • Higher heat production

    • Increased food intake

    • Elevated oxygen consumption (especially during dark periods)

    • Higher locomotor activity

    • Lower respiratory exchange ratio (indicating preferential fat metabolism)

Researchers can leverage these models for:

  • Obesity research: Studying how the absence of ATP1B4 prevents fat deposition despite increased food intake

  • Diabetes investigations: Examining mechanisms of improved glucose tolerance and insulin sensitivity

  • Exercise physiology: Analyzing the relationship between increased locomotor activity and metabolic improvements

  • Metabolic reprogramming studies: Investigating how ATP1B4 ablation alters substrate preference for energy production

These knockout models effectively simulate a scenario where a specific stage in mammalian evolution is bypassed, potentially offering insights into alternative evolutionary pathways that might have reduced susceptibility to modern metabolic diseases .

What are the current technical challenges in studying ATP1B4 protein interactions and how can they be overcome?

Studying the interactome of mouse ATP1B4 presents several technical challenges due to its evolutionary divergence, nuclear membrane localization, and tissue-specific expression pattern. These challenges and potential solutions include:

  • Membrane protein solubilization:

    • Challenge: Inner nuclear membrane proteins are difficult to solubilize while maintaining native conformation

    • Solution: Use specialized detergents such as digitonin or mild non-ionic detergents in conjunction with optimized buffer conditions

  • Identification of dynamic and transient interactions:

    • Challenge: The intrinsically disordered Glu-rich domains likely participate in transient interactions that are difficult to capture

    • Solution: Employ proximity labeling techniques such as BioID or APEX2 to identify proteins in close proximity even if interactions are transient

  • Tissue-specific expression:

    • Challenge: Limited expression to skeletal and cardiac muscle tissues complicates isolation

    • Solution: Use muscle-specific cell lines or primary cultures, or develop conditional expression systems in heterologous cell types

  • Distinguishing direct from indirect interactions:

    • Challenge: Determining which interactions are direct versus part of larger complexes

    • Solution: Implement techniques like in vitro binding assays with purified components or fragment-based interaction mapping

  • Systems-level analysis:

    • Challenge: Integrating interaction data into functional networks

    • Solution: Employ computational approaches including network analysis and machine learning to predict functional consequences of the interactions

The split-ubiquitin system has proven particularly valuable for studying membrane protein interactions of ATP1B4, and combining this with truncation analysis helps map specific interaction domains, as demonstrated by the identification of residues 72-98 in the nucleoplasmic domain being critical for SKIP interaction .

How does the evolutionary transition of ATP1B4 function inform our understanding of gene co-option in vertebrate evolution?

The evolutionary history of ATP1B4 represents an exceptional case study in orthologous gene co-option that offers profound insights into evolutionary mechanisms:

  • Mechanism of functional transition:
    The ATP1B4 gene underwent a radical functional shift from encoding a Na,K-ATPase β-subunit in lower vertebrates to a nuclear membrane protein involved in gene regulation in placental mammals. This transition involved the acquisition of an extended N-terminal domain with nuclear localization signals and Glu-rich clusters, while preserving the core structural motifs of X,K-ATPase β-subunits .

  • Interactome complexity as an evolutionary signature:
    Eutherian BetaM acquired a significantly expanded interactome compared to its avian counterpart, suggesting that increasing protein-protein interaction complexity was a key aspect of its functional evolution. The interactome now includes nuclear envelope proteins (LAP-1, Syne1), transcriptional regulators (SKIP, LZIP/CREB3), and metabolic enzymes (HMOX1, HMOX2) .

  • Tissue-specific adaptation:
    The evolutionary transition led to tissue-specific expression in skeletal and cardiac muscle, suggesting adaptation to specialized physiological demands in these tissues .

  • Metabolic implications of gene co-option:
    Studies with knockout mice suggest that this evolutionary transition had significant implications for metabolism. The finding that ATP1B4-deficient mice have improved metabolic parameters implies that the co-option event may have introduced certain metabolic constraints that were advantageous in the evolutionary context of placental mammals .

  • Methodological approaches for studying evolutionary transitions:
    The experimental ablation of ATP1B4 serves as a model for an "alternative evolutionary pathway" - essentially simulating what might have happened if this particular co-option event had not occurred. This approach offers a novel way to study the consequences of evolutionary innovations by reverse engineering them .

This case illustrates how evolutionary changes in protein structure and interactome complexity can create entirely new functions without affecting the original gene locus, providing a mechanism for evolutionary innovation without the need for gene duplication.

What potential applications exist for recombinant mouse ATP1B4 in studying muscle metabolism and disease?

Recombinant mouse ATP1B4 offers several valuable applications for investigating muscle metabolism and related disorders:

  • Metabolic disease modeling:

    • Recombinant ATP1B4 can be used to restore function in ATP1B4-deficient cells or tissues to examine its direct effects on metabolic parameters

    • By manipulating ATP1B4 levels or introducing mutations, researchers can model how alterations in this protein contribute to metabolic dysfunction

  • Protein interaction studies:

    • Purified recombinant ATP1B4 enables controlled in vitro studies of its interactions with transcriptional regulators such as SKIP

    • These studies can elucidate how ATP1B4 influences gene expression patterns critical for muscle development and metabolism

  • Structural biology investigations:

    • High-quality recombinant protein allows for structural studies using X-ray crystallography or cryo-EM

    • Such studies can reveal the molecular basis for ATP1B4's evolutionary transition from a membrane pump subunit to a nuclear regulatory protein

  • Tissue-specific transcriptional regulation:

    • As ATP1B4 interacts with transcriptional regulators, recombinant protein can be used in ChIP-seq or similar approaches to identify genome-wide binding patterns

    • This application helps elucidate how ATP1B4 contributes to muscle-specific gene expression programs

  • Development of targeted therapeutics:

    • Understanding the unique metabolic phenotype of ATP1B4-deficient mice suggests that modulators of ATP1B4 function might hold therapeutic potential for metabolic disorders

    • Recombinant protein can serve as a platform for screening small molecule modulators of ATP1B4 function or interactions

These applications highlight how recombinant mouse ATP1B4 serves as both an investigative tool for basic research and a potential platform for translational medicine focused on metabolic disorders.

How can researchers differentiate between the ancestral and evolutionarily acquired functions of ATP1B4 in experimental designs?

Differentiating between ancestral and acquired functions of ATP1B4 requires careful experimental design that accounts for its evolutionary transition:

  • Comparative species approaches:

    • Utilize recombinant ATP1B4/BetaM from both eutherian mammals (mouse) and non-eutherian species (birds, amphibians)

    • Compare subcellular localization, interacting partners, and functional outcomes between species to isolate ancestral versus acquired functions

    • No new interactions were found for chicken BetaM compared to eutherian BetaM, highlighting the uniqueness of the mammalian interactome

  • Domain-specific manipulation:

    • Generate chimeric proteins containing domains from both eutherian and non-eutherian ATP1B4

    • Create truncation mutants that specifically remove acquired domains (such as the N-terminal Glu-rich region)

    • Analysis of truncated forms has demonstrated that residues 72-98 adjacent to the membrane in the nucleoplasmic domain are critical for interaction with transcriptional regulators like SKIP

  • Functional assays:

    • Assess Na,K-ATPase activity (ancestral function) using appropriate biochemical assays

    • Evaluate gene regulatory capabilities (acquired function) through transcriptional reporter assays

    • Eutherian BetaM has completely lost its ancestral function as a Na,K-ATPase subunit

  • Subcellular localization studies:

    • Monitor protein targeting to either plasma membrane (ancestral) or inner nuclear membrane (acquired)

    • Use fluorescently tagged constructs with domain-specific mutations to determine which regions drive localization

    • Eutherian BetaM has become a muscle-specific resident of the inner nuclear membrane

  • Evolutionary reconstruction:

    • Utilize ancestral sequence reconstruction to generate proteins representing evolutionary intermediates

    • Test these reconstructed proteins for both ancestral and acquired functions to map the evolutionary trajectory

These methodological approaches allow researchers to systematically distinguish between ancestral and acquired functions of ATP1B4, providing insights into both its evolutionary history and current physiological roles.

What are the optimal expression systems for producing functional recombinant mouse ATP1B4?

Various expression systems are available for producing recombinant mouse ATP1B4, each with distinct advantages for specific research applications:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coli- High yield
- Low cost
- Rapid production
- Suitable for structural studies
- Lacks mammalian post-translational modifications
- May form inclusion bodies requiring refolding
- May have endotoxin contamination
- Protein-protein interaction studies
- Structure-function analyses
- Antibody production
Yeast (e.g., Pichia pastoris)- Moderate yield
- Some post-translational modifications
- Eukaryotic folding machinery
- Glycosylation patterns differ from mammals
- Longer production time than E. coli
- Functional studies requiring basic glycosylation
- Solubility screening
Baculovirus/Insect cells- Higher-order eukaryotic expression
- Complex folding capabilities
- Better solubility for membrane proteins
- Moderate cost
- More complex methodology
- Glycosylation differs from mammals
- Studies requiring proper protein folding
- Analysis of protein complexes
Mammalian cell lines- Native-like post-translational modifications
- Proper protein folding
- Authentic subcellular targeting
- Highest cost
- Lower yields
- Technical complexity
- Studies of nuclear localization
- Interaction with mammalian partners
- Functional assays
In Vivo Biotinylation in E. coli- Site-specific biotinylation
- Facilitates protein detection and purification
- Limited to applications requiring biotinylation
- May affect protein function
- Pull-down assays
- Protein complex identification

What experimental approaches can resolve contradictory findings in ATP1B4 research?

Resolving contradictory findings in ATP1B4 research requires methodical approaches that address potential sources of variability:

  • Standardization of recombinant protein preparations:

    • Implement consistent expression systems across studies (E. coli, mammalian cells, etc.)

    • Standardize purification protocols to ensure comparable protein quality and activity

    • Verify protein integrity through SDS-PAGE and mass spectrometry before functional assays

  • Control for isoform and species-specific differences:

    • Clearly differentiate between eutherian and non-eutherian ATP1B4/BetaM in experimental designs

    • Account for species-specific differences in protein sequences and post-translational modifications

    • The evolutionary transition between avian and mammalian ATP1B4 resulted in significant functional differences that must be considered when comparing across species

  • Context-dependent functional analysis:

    • Evaluate function in physiologically relevant contexts (muscle cells for eutherian ATP1B4)

    • Consider developmental timing, as ATP1B4 expression is highest during perinatal development

    • Assess potential compensation mechanisms in knockout models that might mask primary effects

  • Integrated multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics to develop a comprehensive understanding

    • Use systems biology approaches to interpret seemingly contradictory findings within broader networks

    • Integrate data from ATP1B4-deficient mouse models showing significant metabolic alterations

  • Rigorous validation of protein interactions:

    • Confirm interactions using multiple methodologies (e.g., yeast two-hybrid plus co-immunoprecipitation)

    • Map interaction domains through systematic truncation and mutation analysis

    • The residues 72-98 in the nucleoplasmic domain have been identified as critical for interaction with SKIP, exemplifying how domain mapping can resolve functional questions

By implementing these approaches, researchers can address contradictory findings in ATP1B4 research and develop a more coherent understanding of its functions across evolutionary contexts and experimental systems.

What are the emerging research trends and future directions in ATP1B4 research?

Emerging research trends and future directions in ATP1B4 research span multiple dimensions of biological investigation:

  • Metabolic regulation mechanisms:

    • Elucidating the molecular pathways linking ATP1B4 to the dramatic metabolic phenotypes observed in knockout mice

    • Investigating how ATP1B4 influences glucose metabolism, insulin sensitivity, and adiposity

    • Determining whether ATP1B4 modulators could serve as novel therapeutic agents for metabolic disorders

  • Evolutionary biology insights:

    • Reconstructing the evolutionary trajectory that led to the functional transition of ATP1B4

    • Identifying selective pressures that drove the co-option of this gene in placental mammals

    • Using comparative genomics to identify similar examples of gene co-option across vertebrate evolution

  • Transcriptional regulation networks:

    • Mapping the gene regulatory networks influenced by ATP1B4 in muscle tissues

    • Determining how ATP1B4 interfaces with muscle-specific transcription factors

    • Investigating potential roles in muscle development, performance, and aging

  • Structural biology advancements:

    • Resolving the three-dimensional structure of eutherian ATP1B4, particularly its unique N-terminal domain

    • Understanding how structural changes enabled new protein-protein interactions

    • Using structure-based approaches to develop specific modulators of ATP1B4 function

  • Translational applications:

    • Exploring ATP1B4 as a potential therapeutic target for metabolic diseases

    • Investigating connections between ATP1B4 and muscle-related pathologies

    • Developing ATP1B4-based biomarkers for metabolic health assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.