Recombinant Mouse Protein BEAN1 (Bean1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
Bean1; Protein BEAN1; Brain-expressed protein associating with Nedd4; BEAN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Bean1
Target Protein Sequence
MSFKRPCPLARYNRTSYFYPTTFSESSEHSHLLVSPVLVASAVIGVVITLSCITIIVGSI RRDRQARIQRHHHRHRRHHHHHRHRRRRHREYASGGHTHSRSSPRMPYACSPAEDWPPPL DVSSEGDVDVTVLWELYPDSPPGYEECMGPGATQLYVPTDAPPPYSMTDSCPRLNGALDS DSGQSRSHRQQEQRTQGQSRLHTVSMDTLPPYEAVCGTGSPSDLLPLPGPEPWPSNSQGS PIPTQAPMPSPERIV
Uniprot No.

Target Background

Database Links

KEGG: mmu:65115

UniGene: Mm.41849

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the current understanding of BEAN1's role in immune regulation?

BEAN1 appears to play a significant role in modulating immune cell populations within tumor microenvironments. Research demonstrates that BEAN1 expression shows strong correlations with specific immune cell types, suggesting an immunoregulatory function.

When investigating this protein, researchers should employ comprehensive immune infiltration analysis methods including quantitative immunohistochemistry, flow cytometry of dissociated tissues, and transcriptomic profiling. Multiple algorithms such as CIBERSORT, quanTIseq, MCP-counter, and EPIC can be used for computational immune profiling, as demonstrated in recent studies .

The relationship between BEAN1 and immune cell populations shows several statistically significant correlations:

Immune Cell TypeCorrelation with BEAN1Correlation CoefficientStatistical Significance
EosinophilsPositiver = 0.30p < 0.001
B cell memoryPositiver = 0.28p < 0.001
M2 macrophagesPositiver = 0.24p < 0.001
CD4+ T cellsPositiver = 0.45p < 0.001
Activated NK cellsNegativer = -0.42p < 0.001
Treg cell recruitingNegativer = -0.75p < 0.001
CD8+ T cell recruitingNegativer = -0.37p < 0.001

These data suggest BEAN1 may promote an immunosuppressive tumor microenvironment by enhancing cells associated with immune suppression while reducing anti-tumor immune responses .

How should researchers design experiments to reliably detect and quantify BEAN1 expression?

For reliable detection and quantification of BEAN1, researchers should implement a multi-modal approach combining genomic, transcriptomic, and proteomic techniques. RNA-seq or qPCR provides sensitive detection of mRNA expression, while Western blotting and immunohistochemistry allow protein-level detection.

When conducting immunohistochemical analysis, researchers should follow protocols similar to those used in the Human Protein Atlas database, with careful attention to antibody validation and staining optimization. Comparing expression between different tissue types (e.g., tumor vs. normal) requires consistent staining conditions and appropriate controls .

For quantitative analysis, researchers can stratify samples into high and low BEAN1 expression groups based on median expression values, followed by differential expression analysis using packages like DESeq2. This approach allows identification of genes and pathways co-regulated with BEAN1. Statistical thresholds should be set at adjusted p-value < 0.05 and |log2FoldChange| > 1 for stringent analysis .

What expression patterns does BEAN1 show across different tissues and pathological conditions?

While comprehensive normal tissue expression data is limited in the available research, BEAN1 demonstrates distinctive expression patterns in pathological states, particularly in rectal adenocarcinoma (READ). Immunohistochemistry data from the Human Protein Atlas reveals different staining intensities between colorectal adenocarcinoma (COAD) and rectal adenocarcinoma tissues .

When analyzing BEAN1 expression in pathological conditions, researchers should consider several clinical parameters that show significant associations:

These correlations indicate that BEAN1 expression increases with disease progression in rectal cancer, suggesting potential utility as a prognostic biomarker. Researchers should employ standardized scoring systems for expression quantification and ensure consistent classification criteria when comparing across different sample cohorts .

How can researchers investigate BEAN1's role in chemotherapy resistance mechanisms?

To investigate BEAN1's role in chemotherapy resistance, researchers should implement a comprehensive experimental approach combining in vitro, in vivo, and clinical correlation studies. Current research indicates that BEAN1 expression correlates with resistance to standard chemotherapeutic agents, particularly in colorectal cancer models .

Methodologically, researchers should establish cell line models with controlled BEAN1 expression (overexpression and knockdown) to directly assess its impact on drug sensitivity. Drug response should be quantified using established assays such as MTT, colony formation, and apoptosis measurements. The Genomics of Drug Sensitivity in Cancer (GDSC) database provides valuable reference data for IC50 determination using ridge regression approaches .

For in-depth analysis of resistance mechanisms, researchers should:

  • Investigate alterations in key signaling pathways using phospho-proteomics

  • Assess expression changes in established resistance genes

  • Measure stemness indices using algorithms like the one-class logistic regression (OCLR)

  • Calculate IC50 values for standard agents like 5-FU across BEAN1-high and BEAN1-low groups

Patient-derived xenografts with varying BEAN1 expression levels provide valuable preclinical models for validating in vitro findings and testing combination therapies that might overcome BEAN1-mediated resistance .

What bioinformatic approaches should be used to identify BEAN1-associated pathways and networks?

Researchers investigating BEAN1-associated pathways should implement a multi-layered bioinformatic approach as demonstrated in recent studies. Gene Ontology (GO), Kyoto Encyclopedia of Genes and Genomes (KEGG), and Gene Set Enrichment Analysis (GSEA) represent core analytical methods for pathway identification .

The recommended methodological workflow includes:

  • Differential expression analysis between BEAN1-high and BEAN1-low samples using DESeq2

  • Functional enrichment analysis using clusterProfiler package with gene sets from MSigDB collections

  • Single-sample GSEA (ssGSEA) using the GSVA package to assess pathway activities in individual samples

  • Network analysis to identify protein-protein interactions and regulatory relationships

For GSEA analysis, researchers should use established gene set collections like c2.cp.all.v2022.1.Hs.symbols.gmt and c5.all.v2022.1.Hs.symbols.gmt, setting significance thresholds at adjusted p-value < 0.05 and FDR < 0.25 .

Visualization of results should employ the ggplot2 package for generating volcano plots of differentially expressed genes and enrichment plots for significant pathways. This comprehensive approach enables identification of both direct BEAN1 interactions and broader pathway alterations associated with BEAN1 expression .

How can researchers develop experimental models to study BEAN1's impact on immune evasion in cancer?

Developing experimental models to study BEAN1's impact on immune evasion requires sophisticated approaches that capture the complexity of tumor-immune interactions. Based on current research showing BEAN1's correlation with immunosuppressive cell populations, researchers should implement the following methodology:

  • Generate syngeneic mouse models with modulated BEAN1 expression:

    • CRISPR/Cas9-mediated BEAN1 knockout in mouse cancer cell lines

    • Stable BEAN1 overexpression using lentiviral vectors

    • Inducible BEAN1 expression systems for temporal control

  • Characterize immune infiltration using complementary techniques:

    • Multi-parameter flow cytometry for immune cell quantification and functional assessment

    • Immunohistochemistry and multiplex immunofluorescence for spatial context

    • Single-cell RNA sequencing for unbiased immune profiling

  • Assess immune evasion mechanisms through:

    • Immune checkpoint expression analysis (PD-L1, CTLA-4, etc.)

    • T-cell killing assays with BEAN1-manipulated targets

    • Myeloid cell functional studies (phagocytosis, cytokine production)

  • Evaluate therapeutic implications by:

    • Testing immune checkpoint inhibitor efficacy in BEAN1-high vs. BEAN1-low models

    • Implementing TIDE algorithm for predicting immunotherapy response

    • Analyzing ESTIMATE scores for tumor microenvironment characterization

The TIDE (Tumor Immune Dysfunction and Exclusion) algorithm and ESTIMATE (Estimation of STromal and Immune cells in MAlignant Tumor tissues using Expression data) method provide computational frameworks for predicting immunotherapy response and quantifying immune infiltration, respectively .

What are the critical quality control steps for producing functional recombinant mouse BEAN1 protein?

Production of high-quality recombinant mouse BEAN1 protein requires rigorous quality control at multiple steps. While specific protocols for BEAN1 are not detailed in the available research, established approaches for similar proteins can be adapted.

The recommended quality control workflow includes:

  • Expression system validation:

    • Verify codon optimization for the selected expression system

    • Confirm protein sequence integrity through DNA sequencing

    • Test expression in small-scale pilot studies before scaling up

  • Purification quality checks:

    • Assess purity by SDS-PAGE with Coomassie and silver staining

    • Confirm identity via Western blotting with specific antibodies

    • Evaluate homogeneity using size exclusion chromatography

    • Verify intact mass by mass spectrometry

  • Functional validation:

    • Develop binding assays for known interaction partners

    • Test biological activity in relevant cell-based assays

    • Assess proper folding using circular dichroism or thermal shift assays

  • Storage stability testing:

    • Determine optimal buffer conditions for long-term stability

    • Evaluate freeze-thaw stability with activity measurements

    • Implement lot-to-lot consistency checks for reproducibility

For immunological applications, additional testing should include endotoxin quantification using the LAL (Limulus Amebocyte Lysate) assay, with acceptance criteria typically set at <1 EU/mg protein for research applications.

What controls are essential when studying BEAN1's effects on cell signaling pathways?

When investigating BEAN1's effects on cell signaling pathways, comprehensive controls are essential to ensure experimental rigor and reproducible results. Based on methodological approaches in current research, the following controls should be implemented:

  • Expression controls:

    • Empty vector transfection controls for overexpression studies

    • Non-targeting shRNA/siRNA controls for knockdown experiments

    • Isogenic cell lines differing only in BEAN1 status

    • Quantitative verification of expression changes at protein and mRNA levels

  • Pathway-specific controls:

    • Positive controls using known pathway activators

    • Negative controls using established pathway inhibitors

    • Dose-response curves to confirm specificity of effects

    • Time-course experiments to capture pathway dynamics

  • Validation across systems:

    • Testing in multiple cell lines to ensure generalizability

    • Primary cell validation of findings from immortalized lines

    • In vivo confirmation of key in vitro observations

    • Patient sample correlation where appropriate

Researchers should employ computational analysis methods similar to those used in functional enrichment studies, including GO, KEGG pathway analysis, and GSEA. Statistical significance should be determined using adjusted p-values < 0.05 and appropriate corrections for multiple testing .

What analytical approaches should be used to correlate BEAN1 expression with clinical outcomes?

Correlating BEAN1 expression with clinical outcomes requires robust analytical approaches that account for confounding factors and establish statistical reliability. Based on current research methodologies, the following analytical framework is recommended:

  • Expression stratification methods:

    • Median-split approach for initial high/low categorization

    • ROC curve analysis to determine optimal cutpoints for outcome prediction

    • Quartile or percentile-based stratification for dose-response relationships

    • Continuous variable analysis to avoid information loss from dichotomization

  • Survival analysis implementation:

    • Kaplan-Meier survival analysis with log-rank tests for comparing groups

    • Univariate and multivariate Cox proportional hazards regression

    • Assessment of proportional hazards assumptions

    • Calculation of hazard ratios with 95% confidence intervals

  • Multivariate adjustment considerations:

    • Control for established prognostic factors (stage, grade, age, etc.)

    • Assess interaction effects between BEAN1 and other variables

    • Implement stratified analyses for relevant clinical subgroups

    • Test model robustness through bootstrap resampling

Statistical significance was established with p-values < 0.05, and results were validated using multiple independent datasets to ensure generalizability. This comprehensive approach provides robust evidence for BEAN1's prognostic significance .

How should researchers address contradictory findings about BEAN1 function across different experimental systems?

When researchers encounter contradictory findings regarding BEAN1 function across different experimental systems, a systematic approach to reconciliation is essential. Contradictions may reflect genuine biological context-dependency rather than experimental artifacts.

The recommended methodological framework includes:

  • Systematic comparison of experimental conditions:

    • Create comprehensive comparison tables documenting all methodological differences

    • Identify key variables that differ between contradictory reports (cell types, species, assay conditions)

    • Implement controlled experiments testing each variable individually

    • Reproduce published protocols exactly before introducing modifications

  • Biological context evaluation:

    • Assess tissue-specific effects through parallel experiments in multiple cell types

    • Examine genetic background influence in different model systems

    • Consider microenvironmental factors that may modify BEAN1 function

    • Evaluate temporal dynamics that might explain seemingly contradictory snapshots

  • Technical validation:

    • Verify antibody specificity using knockdown/knockout controls

    • Confirm recombinant protein activity and proper folding

    • Validate key findings using complementary methodological approaches

    • Implement blinded analysis to minimize confirmation bias

  • Integrated interpretation:

    • Develop unified models that accommodate context-dependent functions

    • Identify conditional factors that determine BEAN1's specific roles

    • Consider BEAN1's involvement in multiple pathways with distinct outcomes

    • Distinguish between direct and indirect effects of BEAN1 modulation

This systematic approach helps distinguish genuine biological complexity from technical artifacts, allowing for more nuanced understanding of BEAN1's multifaceted functions.

What integrative bioinformatic approaches can reveal BEAN1's role in complex disease networks?

Understanding BEAN1's role in complex disease networks requires sophisticated integrative bioinformatic approaches that combine multiple data types and analytical methods. Based on current research methodologies, researchers should implement the following multi-layered analytical strategy:

  • Multi-omics data integration:

    • Correlate BEAN1 expression with genomic, transcriptomic, proteomic, and clinical data

    • Implement dimensionality reduction techniques for integrated visualization

    • Apply network fusion algorithms to identify cross-platform patterns

    • Develop integrative clustering approaches to identify patient subgroups

  • Network-based analysis:

    • Construct protein-protein interaction networks centered on BEAN1

    • Identify network modules and hubs associated with BEAN1 expression

    • Apply graph theory metrics to assess network properties

    • Perform network perturbation analysis to predict functional impacts

  • Pathway-centric integration:

    • Utilize GSEA and similar approaches to identify enriched pathways

    • Map differentially expressed genes to established pathway databases

    • Implement tools like clusterProfiler and GSVA for comprehensive pathway analysis

    • Develop pathway activity scores for individual samples using ssGSEA

The integration of immune infiltration data represents a powerful approach, as demonstrated in recent BEAN1 research. Methods such as CIBERSORT, quanTIseq, MCP-counter, EPIC, and ssGSEA provide complementary perspectives on the tumor immune microenvironment, with cross-validation across algorithms enhancing confidence in the findings .

This multi-faceted approach enables researchers to place BEAN1 within the broader context of disease-associated networks and identify key interaction partners and pathways for further functional investigation.

How can researchers develop and validate predictive models incorporating BEAN1 expression for clinical applications?

Developing robust predictive models incorporating BEAN1 expression for clinical applications requires a rigorous methodology that ensures both statistical validity and clinical relevance. Based on current research approaches, the following framework is recommended:

  • Model development strategy:

    • Train initial models on discovery cohorts with appropriate sample sizes

    • Include established prognostic variables alongside BEAN1 expression

    • Test multiple model types (Cox proportional hazards, random forest, support vector machines)

    • Implement regularization techniques to prevent overfitting

  • Feature selection methodology:

    • Use univariate screening to identify candidate predictors

    • Apply LASSO or elastic net regularization for dimension reduction

    • Consider interaction terms between BEAN1 and other variables

    • Incorporate pathway-level information derived from BEAN1-associated genes

  • Validation approach:

    • Implement internal validation using cross-validation and bootstrap resampling

    • Conduct external validation in independent patient cohorts

    • Calculate performance metrics (C-index, AUC, calibration plots)

    • Assess clinical utility through decision curve analysis

  • Clinical implementation considerations:

    • Develop simplified models suitable for clinical application

    • Create nomograms or risk calculators for clinical interpretation

    • Establish risk groups with clear therapeutic implications

    • Compare performance against established prognostic models

In recent research, BEAN1 expression has shown promise as a prognostic biomarker in rectal adenocarcinoma, with significant associations to outcomes demonstrated through Kaplan-Meier survival analysis and Cox regression. The TIDE algorithm has been utilized to predict immunotherapy response based on BEAN1 expression patterns, demonstrating the potential for BEAN1-incorporating models to guide treatment decisions .

Comprehensive validation across multiple independent datasets is essential, as demonstrated in recent studies that confirmed findings using both public databases and institutional cohorts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.