Recombinant Mouse Protein CLN8 (Cln8)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lysosomal Homeostasis

Recombinant CLN8 has been pivotal in elucidating its dual roles:

Lipid Metabolism

  • Catalyzes the acylation of lysophosphatidylglycerol (LPG) to form R,S-BMP, a lysosomal phospholipid .

  • Substrate preference for polyunsaturated acyl-CoA (e.g., DHA-CoA, 18:2-CoA) .

Recombinant CLN8 ActivityFindings
Acyltransferase assay (18:1-LPG + oleoyl-CoA)14C-labeled product co-migrates with R,S-dioleoyl-BMP standard
LC-MS/MS analysisConfirms BMP-specific monoacylglycerol fragments

Lysosomal Enzyme Trafficking

  • Forms a complex with CLN6 to recruit lysosomal enzymes (e.g., tripeptidyl peptidase 1) at the ER, facilitating Golgi transfer via COPII vesicles .

  • Deficiency disrupts enzyme transport, leading to lysosomal dysfunction and neurodegeneration .

Therapeutic Applications in Batten Disease Models

Recombinant CLN8 has shown promise in rescuing pathological and behavioral deficits in Cln8 mice:

Gene Therapy Outcomes

  • Survival: scAAV9.pT-MecP2.CLN8 treatment extended lifespan from 10 months (untreated) to >24 months .

  • Neuropathology: Reduced astrocytosis (GFAP immunoreactivity) and microglial activation (CD68 levels) in thalamocortical regions .

ParameterPBS-Treated Cln8 MicescAAV9-CLN8-Treated Mice
Lifespan≤12 months>24 months
ASM accumulation (VPM/VPL)Severe (8 months)Near-WT levels (24 months)
Motor functionProgressive paralysisPreserved mobility

Behavioral Rescue

  • Restored associative learning and electroretinogram responses .

Disease-Linked Mutations and Functional Studies

Recombinant CLN8 variants mirror human and murine mutations:

  • Pathogenic Mutations: H139Y, R204C/L (Batten disease) disrupt acyltransferase activity .

  • Mouse mnd Model: Frameshift mutation (267–268insC) causes ER retention and lysosomal enzyme depletion .

Expression and Localization Insights

  • Neuronal Localization: In hippocampal neurons, CLN8 localizes to ER dendrites and axons, with partial ERGIC distribution .

  • Polarized Trafficking: Basolateral targeting in epithelial cells suggests tissue-specific sorting mechanisms .

Future Research Directions

  • Mechanistic Studies: Resolve CLN8-CLN6 complex structure to refine enzyme recruitment models .

  • Therapeutic Optimization: Enhance AAV9-CLN8 delivery efficiency to mitigate retinal degeneration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order remarks section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipment, please communicate this requirement in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own adjustments.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag preference, please inform us, and we will prioritize its development.
Synonyms
Cln8; Protein CLN8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cln8
Target Protein Sequence
MTPVSSHGLAESIFDLDYASWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLAAKE KVFWNLAATRAVFGVQSTTAGLWALLGDPVLYADKALGQQNWCWFHITTATGFFFFENVA VHLSNLFFRTFDLFLVVHHLFAFLGFLGSAINLRAGHYLAMTTLLLEMSTPFTCISWMLL KAGWSDSLFWKANQWLMIHMFHCRMILTYHMWWVCFCHWDALTSSLHLPHWALFLFGLAL LTAVINPYWTHKKTQQLLHPVDWNFAQEEAKGSRQERTNGQVPRKKRL
Uniprot No.

Target Background

Function
CLN8 plays a potential role in cell proliferation during neuronal differentiation and in safeguarding against cell death.
Gene References Into Functions
  1. This study highlighted selective spatiotemporal patterns of glial activation and neuron loss in the sensory thalamocortical pathways in neuronal ceroid lipofuscinosis 8 deficiency mice. PMID: 22569358
  2. Myelin levels were reduced in 1-month-old Cln8(mnd) mice but returned to normal by 5 months of age. Cln8 gene expression mirrored the developmental pattern of myelin formation and was elevated in primary oligodendrocytes. PMID: 22044361
  3. This study examined the changes in glutamate receptor expression within the hippocampus of the mnd mouse. PMID: 22302580
  4. Mutations in the mouse CLN8 gene demonstrate a significant deficiency in mitochondrial Ca2+ clearance in Cln8mnd neurons, leading to increased vulnerability of these neurons to the excitotoxic effects of glutamate. PMID: 21917311
  5. The mnd mouse mutation in CLN8 results in progressive behavioral abnormalities preceding the onset of gross motor symptoms, linking the mutation via pathology to a quantifiable behavioral phenotype. PMID: 12020865
  6. A substantial increase in astroglial and microglial cells, as well as TNF receptor TNFR-I immunoreactivity, was observed in the spinal cord of motor neuron degeneration mutation (mnd) mice at 4 months of age. PMID: 14698139
  7. Mutations in the CLN8 gene are associated with Northern epilepsy and a subset of Turkish variant late infantile NCL. Induced disease mutations in a mouse hippocampal neuronal cell line did not affect CLN8 localization. PMID: 15160397
  8. Expression of Cln8 in the developing and mature brain suggests roles for Cln8 in maturation, differentiation, and supporting the survival of various neuronal populations. PMID: 15826318

Show More

Hide All

Database Links
Involvement In Disease
Defects in Cln8 are the cause of the phenotype motor neuron degeneration (mnd). Mnd is a naturally occurring mutant It is characterized by progressive motor system degeneration. It has intracellular autofluorescent inclusions similar to those seen in human Cln8.
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is CLN8 and which protein family does it belong to?

CLN8 (also known as TLCD6) belongs to the TRAM-LAG1-CLN8 (TLCD) family of proteins. These proteins function as enzymes that remodel cellular phospholipids and expand membrane lipid diversity . CLN8 is specifically classified as an acyltransferase that localizes to the endoplasmic reticulum (ER)-Golgi network . The protein contains conserved domains that are essential for its enzymatic activity, with mutations in these regions often associated with disease states .

What is the primary biochemical function of CLN8 protein?

CLN8 functions as a lysophosphatidylglycerol acyltransferase that catalyzes a critical step in the bis(monoacylglycero)phosphate (BMP) synthesis pathway . Specifically, it catalyzes the headgroup acylation of lysophosphatidylglycerol (LPG) to produce R,S-BMP, which is an intermediate in the formation of mature lysosomal S,S-BMP . This acyltransferase activity has been confirmed through in vitro assays using both radiolabeled substrates and LC-MS/MS analysis, where CLN8 showed preference for polyunsaturated linoleoyl-CoA (18:2) and docosahexaenoic acid (DHA)-CoA substrates when presented with an equimolar acyl-CoA mix .

How does CLN8 contribute to cellular lipid homeostasis?

CLN8 plays an essential role in lysosomal phospholipid metabolism, particularly in the biosynthesis of BMP, a unique phospholipid enriched in late endosomes and lysosomes . In CLN8 knockout cellular models, lipidomic analyses revealed a near-complete absence of lysosomal BMP species, indicating CLN8's critical role in this pathway . The enzyme catalyzes the acylation of R,S-LPG in the ER/Golgi to produce R,S-BMP intermediate, which subsequently undergoes phosphoryl ester migration and processing to form S,S-BMP in lysosomes . This process highlights CLN8's importance in maintaining lysosomal membrane composition and function, with disruptions potentially leading to lysosomal storage disorders like Batten disease .

How do mutations in CLN8 contribute to Batten disease pathology?

Mutations in the CLN8 gene cause a rare form of late-infantile Batten disease, a fatal neurodegenerative lysosomal storage disorder . The disease is characterized by the toxic accumulation of insoluble waste deposits (lipofuscins) inside cells' recycling centers, leading to abnormal activation of glial cells and neurodegeneration . At the molecular level, CLN8 mutations disrupt its acyltransferase activity, preventing proper BMP synthesis . ClinVar reports multiple types of pathogenic mutations, including missense (8), frameshift (14), nonsense (21), and splice site (1) variants . Notably, mutations in conserved histidine and arginine residues (H139Y, R204C, and R204L) have been frequently observed in CLN8 in patients with Batten disease, suggesting these are critical for enzymatic function . The absence of functional CLN8 leads to lysosomal phospholipid dysregulation, particularly affecting BMP levels, which appears to be a common pathological mechanism in several Batten disease variants .

What sex-specific differences have been observed in CLN8 disease models?

Significant sex-specific differences have been documented in mouse models of CLN8-Batten disease . Female mice consistently show a faster and more severe disease progression than their male counterparts . Specifically, female mice demonstrated:

Interestingly, while male mice showed earlier and more severe waste product accumulation than females initially, this difference disappeared at later time points, suggesting females experience faster progression once pathology begins . These findings highlight that biological sex significantly influences disease outcomes in CLN8-Batten disease, potentially through differential inflammatory responses in the brain .

What cellular and molecular pathologies are characteristic of CLN8 deficiency?

CLN8 deficiency leads to several distinctive cellular and molecular pathologies that have been well-characterized in mouse models:

  • Accumulation of storage material: Progressive accumulation of lipofuscins and other waste products in the brain, with timing differences between sexes

  • Mitochondrial dysfunction: Accumulation of mitochondrial ATP synthase subunit C (SubC), a major constituent of the storage material in NCLs

  • Neuroinflammation: Early microglial activation (before 3 months of age), followed by astrocytosis . This is evidenced by:

    • Increased CD68 immunoreactivity in specific brain regions (VPM/VPL and S1BF)

    • Hypertrophic microglial morphology with little ramification

    • Elevated GFAP immunoreactivity indicating profound astrocytosis

    • Hypertrophic, intensely GFAP-positive astrocytes typical of neurodegenerative responses

  • BMP deficiency: Near-complete absence of lysosomal phospholipid BMP species, which can be restored with CLN8 expression

These pathologies collectively contribute to the progressive neurodegeneration and behavioral deficits observed in CLN8-related Batten disease .

What are the recommended approaches for studying CLN8 function in vitro?

When investigating CLN8 function in vitro, several methodological approaches have proven effective:

  • CRISPR-Cas9 gene editing: Generation of CLN8 knockout cell lines (e.g., HeLa and U-2OS) provides a valuable tool for studying CLN8's role in phospholipid metabolism . This approach allows comparison of lipidomes between wild-type and CLN8-deficient cells.

  • Lipidomic analysis: Mass spectrometry-based lipidomics can detect changes in phospholipid species, particularly BMP, which is severely depleted in CLN8 knockout cells . This technique is essential for characterizing the specific lipid species affected by CLN8 deficiency.

  • Acyltransferase activity assays: In vitro enzyme activity can be assessed using:

    • Radiolabeled substrates (e.g., [1-14C]-oleoyl-CoA) with thin-layer chromatography (TLC) for product identification

    • LC-MS/MS monitoring of BMP-specific monoacylglycerol fragment transitions in time-course assays with purified CLN8, LPG, and unlabeled acyl-CoA

    • Substrate preference determination using equimolar acyl-CoA mixes

  • Molecular docking: Computational approaches using AlphaFold2-predicted structures can identify conserved residues essential for substrate binding and catalysis . This method helps predict how specific mutations might affect enzyme function.

  • Protein localization studies: Immunofluorescence and subcellular fractionation can confirm CLN8's localization to the ER-Golgi network .

These complementary approaches provide a comprehensive toolkit for dissecting CLN8's enzymatic function and role in phospholipid metabolism.

What genetic approaches are most effective for identifying CLN8 mutations in clinical samples?

Effective genetic approaches for identifying CLN8 mutations include:

  • Whole-genome sequencing: This approach provides comprehensive coverage at 30× depth and has proven valuable for investigating the genetic underpinnings of rare diseases like CLN8-related NCL . It can detect various mutation types, including those that might be missed by targeted approaches.

  • Microarray analysis: Particularly recommended for patients suspected of NCL who appear homozygous for a mutation not present in one parent or when the family has no known consanguinity . This is crucial for detecting large genomic deletions that can unmask mutations on the other chromosome.

  • Compound heterozygosity assessment: Important for identifying cases where different mutations are present on each allele, as seen in patients carrying deletions that encompass the 37 kb CLN8 gene .

  • ClinVar database consultation: Currently reports eight missense, 14 frameshift, 21 nonsense, and one splice site CLN8 mutations classified as pathogenic, providing valuable reference information .

  • NCL resource utilization: The UCL NCL disease resource (https://www.ucl.ac.uk/ncl-disease/) provides additional information about mutations specifically associated with CLN8 disorder .

It's worth noting that missense mutations appear to be an unusual or under-detected cause in CLN8-related disorders based on ClinVar data, suggesting the importance of comprehensive genetic approaches that can detect various mutation types .

What are the optimal methods for measuring BMP levels in cellular models of CLN8 deficiency?

Optimal methods for measuring BMP levels in cellular models include:

  • Lipidomic analysis via LC-MS/MS: This technique allows for precise identification and quantification of different BMP species, which is crucial as the profile of BMP species can vary between cell types (e.g., U-2OS cells show distinctive BMP species enriched in docosahexaenoic acid compared to HeLa cells) . The method can detect near-complete absence of BMP species in CLN8 knockout cells and monitor restoration upon CLN8 reintroduction .

  • Radiolabeled precursor incorporation: Using radiolabeled substrates such as [1-14C]-oleoyl-CoA combined with TLC can track the formation of BMP in enzyme assays, allowing for comparative migration analysis against R,S-dioleoyl-BMP standards .

  • BMP-specific fragment monitoring: Tracking BMP-specific monoacylglycerol fragment transitions provides a sensitive method for detecting BMP formation in time-course assays .

  • Rescue experiments: Transfecting CLN8 knockout cells with CLN8-HA can confirm the specificity of BMP deficiency by demonstrating restored BMP levels, with consideration that restoration may be complete or partial depending on cell type .

These methods should be employed with appropriate controls and multiple biological replicates to ensure reliable quantification of BMP levels in the context of CLN8 deficiency.

How effective are gene therapy approaches for CLN8-related disorders?

Gene therapy approaches, particularly those using adeno-associated virus serotype 9 (AAV9), have shown remarkable efficacy in treating CLN8-related disorders in preclinical models . Key findings include:

These findings suggest AAV9-mediated gene therapy is a promising approach for CLN8-related disorders, providing more substantial improvements than any other therapy documented in Cln8mnd mice .

What is the proposed mechanism of BMP synthesis involving CLN8 and how does it relate to Batten disease pathology?

The proposed mechanism of BMP synthesis involving CLN8 elucidates a multi-step pathway essential for lysosomal lipid homeostasis :

  • CLN8 catalyzes the acylation of R,S-LPG in the ER/Golgi to produce the R,S-BMP intermediate .

  • This R,S-BMP intermediate undergoes a rearrangement where the phosphoryl ester migrates from the sn-3 to the sn-1 position, releasing the sn-1 linked acyl chain . This migration is catalyzed by an as-yet unidentified enzyme .

  • The rearrangement results in the formation of S,S-LPG intermediate, which is then trafficked to the lysosome .

  • In the lysosome, another Batten disease-related protein, CLN5, uses S,S-LPG to generate mature S,S-BMP .

This pathway aligns with prior evidence showing that:

  • Fatty acyl-CoA synthesis is necessary for BMP biosynthesis

  • BMP formation involves removal of both acyl groups while retaining both glycerol moieties from the precursor phosphatidylglycerol during conversion

In Batten disease pathology, mutations in CLN8 disrupt this pathway, preventing proper BMP synthesis and leading to lysosomal dysfunction . The absence of BMP species in CLN8-deficient cells confirms the critical role of this enzyme in the pathway . This finding underscores lysosomal phospholipid dysregulation as a common pathological mechanism in various Batten disease variants and highlights the importance of the BMP synthesis pathway in lysosomal function .

How do structural features of CLN8 relate to its enzymatic activity and disease-causing mutations?

The structural features of CLN8 provide crucial insights into its enzymatic mechanism and how mutations lead to disease :

  • Conserved domains: Molecular docking of 18:1-LPG to the AlphaFold2-predicted structure of CLN8 revealed conserved TLCD family residues surrounding the LPG headgroup . These residues are essential for enzyme activity and substrate binding specificity.

  • Critical catalytic residues: Conserved histidine and arginine residues (specifically positions H139 and R204) have been identified as frequently mutated in CLN8 in patients with Batten disease (H139Y, R204C, and R204L mutations) . These residues likely play crucial roles in substrate recognition, binding, or catalysis.

  • Substrate preferences: CLN8 shows preference for polyunsaturated acyl-CoA substrates, particularly linoleoyl-CoA (18:2) and DHA-CoA, suggesting a binding pocket optimized for these fatty acid chains . This preference may be dictated by specific structural features of the enzyme's active site.

  • Structural homology: As part of the TRAM-LAG1-CLN8 family, CLN8 shares structural features with other acyltransferases that remodel cellular phospholipids . This structural conservation underscores its evolutionary importance in lipid metabolism.

  • Mutation impacts: The various mutation types reported in ClinVar (missense, frameshift, nonsense, and splice site) likely disrupt protein structure in different ways, affecting folding, substrate binding, catalysis, or protein stability . This structural diversity of mutations may explain the phenotypic spectrum observed in CLN8-related disorders.

Understanding these structure-function relationships can guide rational approaches to therapeutic development and provide mechanistic insights into disease pathology.

What are the implications of large genomic deletions in CLN8 for genetic diagnosis and disease phenotypes?

Large genomic deletions affecting the CLN8 gene have significant implications for genetic diagnosis and disease phenotypes :

  • Diagnostic challenges: Deletions can complicate genetic diagnosis of autosomal recessive CLN8-related disorders . In cases where patients appear homozygous for a mutation, the presence of a deletion on one chromosome can mask heterozygosity, leading to incorrect genetic interpretations .

  • Hemizygosity effects: Patients with deletions encompassing the 37 kb CLN8 gene may be hemizygous for a mutant allele, where deletions unmask a mutation in CLN8 on the other chromosome . This can result in disease manifestation even when only one point mutation is detected by standard sequencing approaches.

  • Phenotypic impact: Three unrelated patients carrying deletions encompassing the CLN8 gene showed distinct phenotypes, suggesting that the size and specific boundaries of deletions may influence disease presentation . These cases challenge established classifications of CLN8-related disorders (vLINCL and EPMR) and suggest a continuous phenotypic spectrum.

  • Diagnostic recommendations: For patients suspected of NCL who appear homozygous for a mutation not present in one parent, or when the family has no known consanguinity, microarray analysis is strongly recommended to detect potential large genomic deletions .

  • Novel disease mechanisms: Large deletions may affect not only CLN8 but also neighboring genes, potentially contributing to more complex phenotypes or altered disease progression compared to point mutations affecting only CLN8 function .

These findings highlight the importance of comprehensive genetic testing approaches that can detect copy number variations in addition to sequence variants for accurate diagnosis of CLN8-related disorders.

What remains unknown about CLN8's interaction with other proteins in the BMP synthesis pathway?

Several critical aspects of CLN8's interactions in the BMP synthesis pathway remain unexplored :

  • Unidentified enzyme partners: The enzyme catalyzing the phosphoryl ester migration from R,S-BMP to form S,S-LPG intermediate has not been identified . This represents a significant knowledge gap in the pathway and could be a potential therapeutic target.

  • CLN8-CLN5 coordination: While both CLN8 and CLN5 participate in BMP synthesis, the mechanisms coordinating their sequential activities across different cellular compartments (ER/Golgi for CLN8 and lysosomes for CLN5) remain unclear . Understanding this spatial and temporal coordination could provide insights into broader lysosomal biogenesis pathways.

  • Transport mechanisms: The processes governing the trafficking of the S,S-LPG intermediate from the ER/Golgi to lysosomes require further investigation . Identifying the transporters involved could reveal additional disease-relevant proteins.

  • Regulatory interactions: Factors regulating CLN8 expression, activity, and turnover remain largely unknown. Potential protein-protein interactions that might modulate CLN8 function represent an important area for future research.

  • Compensatory mechanisms: In CLN8 deficiency, potential compensatory pathways that might partially maintain BMP synthesis have not been fully explored, which could explain phenotypic variations observed in patients with different mutations.

Addressing these questions will require advanced proteomic approaches, proximity labeling techniques, and systematic genetic screens to identify CLN8 interactors and regulators.

How might CLN8-targeted therapies be optimized for sex-specific differences in disease progression?

Given the documented sex differences in CLN8 disease progression, optimization of therapies should consider several factors :

  • Timing of intervention: Since female mice show faster disease progression once pathology begins, earlier therapeutic intervention might be particularly critical for female patients . Clinical trials should consider stratified analysis of treatment timing effects by sex.

  • Dosage considerations: The increased microglia activation and neuroinflammation observed in females may necessitate higher doses or adjunctive anti-inflammatory treatments to achieve optimal outcomes . Dose-response studies should include sex as a biological variable.

  • Biomarker development: Sex-specific biomarkers of disease progression could help tailor treatment schedules and monitor therapeutic efficacy more precisely . Studies should validate whether certain inflammatory markers might be particularly relevant for female patients.

  • Combination approaches: For female patients, combining CLN8 gene therapy with targeted anti-inflammatory treatments might address the exacerbated microglial activation observed in female disease models .

  • Long-term monitoring: While initial therapeutic responses showed minimal sex differences, continued monitoring for sex-specific differences in long-term outcomes is warranted, particularly for cognitive functions where female mice continued to show deficits after treatment .

Implementing these considerations in preclinical and clinical development programs would align with the growing recognition of sex as a biological modifier in neurodegenerative diseases and could lead to more personalized therapeutic approaches.

What technological advances might improve the study of CLN8 function in complex neural systems?

Emerging technologies hold promise for advancing our understanding of CLN8 function in complex neural systems:

  • Single-cell transcriptomics and proteomics: These approaches could reveal cell type-specific expression patterns and responses to CLN8 deficiency or therapy . This would be particularly valuable for understanding the differential vulnerability of neural populations in CLN8-related disorders.

  • Advanced in vivo imaging: Techniques such as two-photon microscopy combined with genetically encoded indicators for calcium, lysosomal pH, or lipid dynamics could provide real-time visualization of cellular processes affected by CLN8 deficiency in intact neural circuits .

  • Human iPSC-derived brain organoids: Patient-derived induced pluripotent stem cells differentiated into 3D brain organoids could provide more translational models for studying CLN8 function and testing therapeutic approaches in human neural tissue .

  • CRISPR-based screening: Genome-wide or targeted CRISPR screens could identify genetic modifiers of CLN8-related pathology, potentially revealing new therapeutic targets or explaining phenotypic variability .

  • Advanced structural biology: Cryo-electron microscopy and advanced computational modeling could provide higher-resolution structures of CLN8 in complex with substrates or potential interacting partners, informing structure-based drug design approaches .

  • Spatial transcriptomics and proteomics: These techniques could map CLN8 expression and function across brain regions with unprecedented spatial resolution, potentially revealing region-specific vulnerabilities and responses to therapy .

These technological advances, particularly when combined in integrative approaches, could significantly accelerate our understanding of CLN8 biology and the development of effective therapies for CLN8-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.