Recombinant Mouse Protein CNPPD1 (Cnppd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cnppd1; Protein CNPPD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnppd1
Target Protein Sequence
MDLTGLLLDEEGAFSLTGFQDFMVLPGHQKLSARIRRRLYYGWDLETDCSLEELSSPVAD ITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVATLNALERSFLSAMDWRLYTDPRE IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV SSVALAVASVAVIHQSLGLSSSPSPGPPELTLVSKSLVQPCVPAPVSQCLTNVSSCLEGS VDLPSLWGSLLAPLTPPLRPPPDPPAPPTPLHKCPLCQKFQRLPPNCRACHTNQTVSIGP SRPLYHARGLAPPWLWSPVAPPFLQPQQCSLFSVMELAHLKSVISPG
Uniprot No.

Target Background

Database Links
Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CNPPD1 protein and what are its known functions?

CNPPD1 (Cyclin Pas1/PHO80 Domain Containing 1) is a protein coding gene that is predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity. It is involved in the regulation of cyclin-dependent protein serine/threonine kinase activity and is part of the cyclin-dependent protein kinase holoenzyme complex. The protein is predicted to be active in the nucleus and is an integral component of membrane . In humans, CNPPD1 is a 410 amino acid single-pass membrane protein encoded by a gene located on chromosome 2q35 . Recent studies have implicated CNPPD1 as potentially playing a critical role in certain cancers, including renal cell carcinoma, where it has been identified as one of the differentially expressed genes associated with specific pathways including PI3K-Akt, Foxo, endocytosis, and MAPK signaling .

How is mouse CNPPD1 structurally different from human CNPPD1?

While both mouse and human CNPPD1 contain the characteristic cyclin Pas1/PHO80 domain, there are some species-specific differences. The mouse ortholog (cnppd1) is predicted to act upstream of or within regulation of cyclin-dependent protein serine/threonine kinase activity, similar to its human counterpart. According to cross-species comparison data, both proteins share significant homology but may exhibit differences in post-translational modifications and domain organization . The mouse cnppd1 gene is located on chromosome 1 and the protein contains domains including Cyclin N-terminal and Cyclin PHO80-like domains, which are critical for its function in regulating cell cycle progression .

What expression systems are most suitable for producing recombinant mouse CNPPD1 protein?

For recombinant mouse CNPPD1 production, several expression systems can be considered, each with distinct advantages:

  • Bacterial systems (E. coli): Suitable for high-yield production, though post-translational modifications will be lacking. This system would be appropriate if functional studies don't require glycosylation or other eukaryotic modifications .

  • Yeast expression systems (P. pastoris or S. cerevisiae): These systems offer a balance between bacterial and mammalian systems. P. pastoris can express proteins with human-like glycosylation patterns after appropriate engineering, and recent CRISPR/Cas9 developments have improved its genetic manipulation capabilities .

  • Mammalian expression systems (CHO cells or HEK293): These provide the most native-like post-translational modifications. Recent advances in CRISPR/Cas9 gene editing have improved productivity in these systems. For example, CRISPR/Cas9-mediated site-specific integration has been used to establish stable HEK293 cell lines for biopharmaceutical production .

Selection should be based on your specific research needs, particularly regarding protein folding, post-translational modifications, and yield requirements.

What are the optimal conditions for purifying recombinant mouse CNPPD1?

Based on standard protocols for recombinant protein purification, the following methodological approach is recommended for CNPPD1:

  • Expression tagging: Include a C-terminal 6-His tag to facilitate purification, similar to other recombinant mouse proteins .

  • Initial purification: Use His Mag Sepharose Ni affinity chromatography for primary capture of the tagged protein .

  • Buffer composition: Purify in a PBS-based buffer with optimization for CNPPD1 stability. For carrier-free preparations, lyophilize from a 0.2 μm filtered solution in PBS .

  • Reconstitution: Following purification, reconstitute at 250 μg/mL in PBS, similar to other recombinant mouse proteins of comparable size and structure .

  • Storage considerations: Store lyophilized protein at -20°C and avoid repeated freeze-thaw cycles to maintain structural integrity and activity .

For proteins like CNPPD1 that may form inclusion bodies, solubilization using appropriate reagents followed by refolding with a protein refolding kit may be necessary .

How should I design experiments to evaluate the biological activity of recombinant mouse CNPPD1?

When designing experiments to evaluate the biological activity of recombinant mouse CNPPD1, follow these methodological guidelines:

  • Controls selection:

    • Include both positive controls (known active proteins in the same pathway) and negative controls (inactive protein variants or unrelated proteins like MyoD)

    • Consider using carrier-free protein for experiments where BSA might interfere with biological activity assessment

  • Activity assays:

    • Design kinase activity assays focusing on cyclin-dependent protein kinase regulation, given CNPPD1's predicted function

    • Include binding assays to evaluate protein-protein interactions with predicted binding partners in the cyclin-dependent protein kinase complex

  • Experimental validation:

    • Use multiple cell lines relevant to CNPPD1 function (consider neural stem cells based on its expression pattern)

    • Implement both gain-of-function (adding recombinant protein) and loss-of-function (siRNA knockdown) approaches in parallel

    • Measure downstream pathway activation using phosphorylation-specific antibodies for signaling proteins in the PI3K-Akt and MAPK pathways

  • Statistical considerations:

    • Include sufficient biological replicates (minimum n=3) to account for variability

    • Apply appropriate statistical tests based on data distribution

    • Consider potential batch effects and implement appropriate randomization and blocking in experimental design

What controls and validation methods should be employed when studying recombinant mouse CNPPD1?

A comprehensive validation strategy for recombinant mouse CNPPD1 studies should include:

Protein validation:

  • SDS-PAGE analysis: Confirm protein purity and expected molecular weight (~45-50 kDa plus tag size)

  • Western blot: Verify identity using anti-CNPPD1 antibodies

  • Mass spectrometry: Confirm protein sequence and identify any post-translational modifications

  • Circular dichroism: Assess proper protein folding and secondary structure

Functional validation:

  • Cell-based assays: Test the protein's ability to regulate cyclin-dependent kinase activity in relevant cell lines

  • Binding assays: Verify interactions with known or predicted protein partners using co-immunoprecipitation or surface plasmon resonance

  • Nuclear localization: Confirm the protein's ability to translocate to the nucleus using fluorescently tagged protein or immunofluorescence

Controls:

  • Negative controls: Include a similarly produced recombinant protein with unrelated function (e.g., recombinant mouse MyoD fusion protein)

  • Carrier-free controls: Compare carrier-free preparations with BSA-containing preparations to assess the impact of BSA on experimental outcomes

  • Heat-inactivated protein: Use heat-denatured CNPPD1 as a negative control for structure-dependent activities

How does recombinant CNPPD1 contribute to understanding cell cycle regulation in mouse models?

Recombinant CNPPD1 serves as a valuable tool for elucidating cell cycle regulation mechanisms, particularly through the following methodological approaches:

  • Cyclin-dependent kinase (CDK) pathway analysis: As CNPPD1 is predicted to regulate CDK activity, exogenous recombinant protein can be used to modulate this pathway in controlled experiments. This allows researchers to observe downstream effects on cell cycle progression, particularly at checkpoints regulated by CDKs .

  • Structure-function relationship studies: Domain-specific mutations in recombinant CNPPD1 can reveal how specific regions (e.g., the Cyclin N-terminal and Cyclin PHO80-like domains) contribute to its regulatory function in cell cycle control .

  • Interaction network mapping: Purified recombinant CNPPD1 can be used in pull-down assays to identify previously unknown protein-protein interactions within the cell cycle regulatory network, potentially revealing new connections to established pathways like PI3K-Akt, which has been implicated in CNPPD1-related function .

  • Tissue-specific effects: By introducing recombinant CNPPD1 to different cell types derived from mouse models, researchers can determine if its cell cycle regulatory functions are conserved across tissues or exhibit context-dependent effects.

  • Disease model relevance: The altered expression of CNPPD1 in cancer models suggests it may have tissue-specific roles in pathological cell cycle regulation, particularly in renal cell carcinoma where it has been identified as a differentially expressed gene .

What pathways might be affected by recombinant CNPPD1 treatment in experimental settings?

Based on available data, recombinant CNPPD1 treatment may impact several key signaling pathways:

  • PI3K-Akt signaling pathway: CNPPD1 has been identified as a gene associated with alterations in the PI3K-Akt pathway in renal cell carcinoma . This pathway is central to cell survival, proliferation, and metabolism, suggesting CNPPD1 may modulate these processes.

  • MAPK signaling cascade: CNPPD1 appears to be associated with MAPK pathway alterations , potentially affecting cellular responses to growth factors and stress signals.

  • Foxo signaling pathway: Association with this pathway suggests CNPPD1 may influence cellular processes regulated by Foxo transcription factors, including cell cycle arrest, apoptosis, and oxidative stress resistance .

  • Endocytosis and vesicular trafficking: CNPPD1's association with endocytosis pathways suggests it may play a role in protein internalization and trafficking, potentially affecting receptor signaling dynamics .

  • Tight junction pathways: Connections to tight junction pathways indicate potential roles in cell-cell contacts and epithelial/endothelial barrier function .

When treating cells with recombinant CNPPD1, researchers should consider monitoring these pathways using phosphorylation-specific antibodies, reporter constructs, or transcriptional profiling to fully characterize the protein's functional impact.

What are common issues in producing active recombinant mouse CNPPD1 and how can they be addressed?

Problem 1: Low expression yield

  • Cause: Suboptimal codon usage or toxic effects on host cells

  • Solution: Optimize codon usage for the expression system (e.g., E. coli or P. pastoris), similar to approaches used for other recombinant proteins . Consider using synthetic genes with codons optimized for the specific expression host. For mammalian expression, evaluate different promoter systems (psbA, atpA) based on their strengths in the chosen system .

Problem 2: Protein insolubility/inclusion body formation

  • Cause: Improper folding in the expression system

  • Solution: Express at lower temperatures (16-25°C), use solubility tags (e.g., MBP, SUMO), or develop a refolding protocol from inclusion bodies using stepwise dialysis . For inclusion bodies, isolate using BugBuster® Reagent, solubilize with Inclusion Body Solubilization Reagent, and refold using a protein refolding kit as described for other recombinant proteins .

Problem 3: Loss of activity during purification

  • Cause: Harsh elution conditions or improper buffer composition

  • Solution: Optimize elution conditions, include stabilizing agents (glycerol, reducing agents), and minimize exposure to extreme pH. Consider carrier proteins like BSA to enhance stability during storage, similar to approaches used for other recombinant mouse proteins .

Problem 4: Post-translational modification issues

  • Cause: Inappropriate expression system for required modifications

  • Solution: Choose expression systems capable of proper modifications (mammalian cells for complex modifications, engineered yeast for simpler patterns). Consider CRISPR/Cas9-engineered CHO or HEK293 cells for mammalian-specific modifications .

Problem 5: Batch-to-batch variability

  • Cause: Inconsistent expression or purification conditions

  • Solution: Implement rigorous quality control at each production step, standardize protocols, and consider continuous bioprocessing approaches for consistent production . Address potential batch effects through proper experimental design including randomization and blocking .

How can researchers interpret contradictory results from studies using recombinant CNPPD1?

When faced with contradictory results in CNPPD1 studies, apply this systematic approach to interpretation:

  • Examine protein preparation differences:

    • Compare protein production systems (bacterial vs. mammalian expression)

    • Assess purity levels and potential contaminant effects

    • Check for presence/absence of carrier proteins (BSA) which may affect results

    • Verify protein activity before experiments

  • Analyze experimental design variations:

    • Identify confounding factors in experimental setup

    • Evaluate statistical power and replicate numbers

    • Check for appropriate controls and blinding procedures

    • Consider batch effects and processing order

  • Evaluate biological context differences:

    • Compare cell types/tissues used (CNPPD1 may have context-dependent effects)

    • Consider passage number of cell lines

    • Assess baseline activation status of relevant pathways

    • Check for genetic differences in models used

  • Statistical analysis considerations:

    • Verify appropriate statistical tests were used

    • Check for proper handling of outliers

    • Consider multiple testing corrections

    • Evaluate effect size alongside statistical significance

  • Reconciliation strategies:

    • Design decisive experiments addressing specific contradictions

    • Use multiple complementary techniques to verify findings

    • Consider combinatorial approaches to identify conditional effects

    • Assess CNPPD1 in its network context rather than in isolation

What are the emerging applications of recombinant mouse CNPPD1 in cancer research?

Recent findings suggest several promising applications for recombinant mouse CNPPD1 in cancer research:

  • Biomarker development: CNPPD1 has been identified among differentially expressed genes with potential clinical significance in terms of survival in renal cell carcinoma . Recombinant CNPPD1 can serve as a standard for developing quantitative assays to measure CNPPD1 levels in patient samples.

  • Pathway intervention studies: As CNPPD1 appears to be associated with critical cancer-related pathways including PI3K-Akt, Foxo, and MAPK signaling , recombinant protein can be used to modulate these pathways in experimental models. This approach may help identify points of therapeutic intervention.

  • Drug discovery platforms: Recombinant CNPPD1 can be utilized in high-throughput screening assays to identify small molecules that modify its activity or interactions, potentially leading to novel therapeutic compounds targeting cancer-specific pathways.

  • Functional genomics validation: In studies where CNPPD1 is identified through multi-omics approaches, recombinant protein can provide functional validation of computational predictions, particularly in determining its role in cellular processes dysregulated in cancer.

  • Combination therapy research: Understanding how CNPPD1-regulated pathways interact with established cancer treatment modalities may reveal synergistic approaches for combination therapies, with recombinant protein studies providing mechanistic insights.

The Kaplan-Meier survival analysis showing clinical significance of CNPPD1 expression in cancer patients suggests that modulating its activity may have therapeutic relevance, making recombinant CNPPD1 an important tool for translational cancer research.

How might advances in recombinant protein technology impact future research on CNPPD1?

Advanced recombinant protein technologies are poised to transform CNPPD1 research in several ways:

  • CRISPR/Cas9 engineered expression systems: Recent developments in CRISPR/Cas9 for cell line engineering will enable more precise control over CNPPD1 expression and modification. For example, CRISPR/Cas9-mediated site-specific integration has been successfully used to establish stable cell lines for biopharmaceutical production , a technique that could be applied to create physiologically relevant models for CNPPD1 study.

  • Cell-free protein synthesis: This emerging technology allows rapid production of recombinant proteins without the constraints of cell viability, potentially accelerating CNPPD1 variant studies and facilitating high-throughput structure-function analyses.

  • Protein fusion technologies: Advanced fusion partners like the CCR9-FOXN1-TAT system could be adapted for CNPPD1 to enhance its cellular uptake and targeting to specific tissues, enabling more precise in vivo studies of its function.

  • Continuous bioprocessing: Innovations in continuous upstream processing and integrated continuous bioprocessing will likely improve the consistency and reduce the cost of producing recombinant CNPPD1, making more complex studies feasible.

  • Quality by Design (QbD) approach: Implementation of QbD principles in recombinant protein production will enhance reproducibility of CNPPD1 preparations, addressing current challenges with batch-to-batch variability .

  • Post-translational modification control: Advanced expression systems with engineered glycosylation pathways will enable production of recombinant CNPPD1 with defined modifications, allowing researchers to study how specific modifications affect its function in regulating cell cycle and other pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.